Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5b107b Olfactory Receptor

Gene Symbol Or5b107b
Organism Rat
Family 5
Subfamily b
Pseudo No
Location chr1:229,991,000-229,992,000 (+)
Aliases Olr351-ps

Sequence information


Nucleotide sequence

ATGACACTAGTGAAGAACTGGGCAGATGTGACATGGTTCATTCTGCTGGGACTCACTGAT
GATCCAAGCCTGAAGCTTCCTCTCCTCATCATCTTTCTCCTCATCTACATCATCACCCTG
GTAGGGAACCTGGGGATGATCCTGCTCATTTTCTTAGACTCTCGGCTCCATTTCCCCATG
TACTTTTTCCTTGGTAACTTGTCCCTGGTGGACTTTTGCTACTCTTCAGCTGTCACTCCT
AAAGTCATAACTGGGCTCCTAATAGGAGACAAGATCATATCTTACAATGACTGTGCTGCT
CAGATGTTCATGTTTGCTGCCTTTGCTACTGTGGAAAATTACCTATTGGCCTCAATGGCC
TATGATCGCTATGCAGCAGTGTGTAAACCCCTACACTATACCACCATCATGACTCCAAAT
TTGTGTATGTATCTAATTATGGGATGCTATATTTTTAGTTTCTTGAATGCCTCAGTTTAC
CTTGGAGATACATTCAGTCTCTCTTTCTGTAAGTCTAATGTGGTCCATCATTTTTTCTGT
GATATGCCAGCAATTATGGCTCTCTCCTGCTCTGATAGACATGTGAATGAGCTAGTACTT
ATTTATCTAGCCAGCTTCAATATCTTCATTGCTTTCATAATGATATTAGTGTCCTACATT
ATAATTTTTATAACAATCTCAAAGATGCACTCAGGAGCAGGATTTCAGAAGGCTCTTTCT
ACCTGTGTCTCTCACTTAACTGTTGTTTTTATTTTCTATGGAACTACAATCTTCATGTAC
TTGCAGCCAAGCTCTAGACATGCAATGGACGCTGACAAAATGGTATCTGTCTTCTACACC
ATGGTCATCCCATGC


Conceptual translation

MTLVKNWADVTWFILLGLTDDPSLKLPLLIIFLLIYIITLVGNLGMILLIFLDSRLHFPM
YFFLGNLSLVDFCYSSAVTPKVITGLLIGDKIISYNDCAAQMFMFAAFATVENYLLASMA
YDRYAAVCKPLHYTTIMTPNLCMYLIMGCYIFSFLNASVYLGDTFSLSFCKSNVVHHFFC
DMPAIMALSCSDRHVNELVLIYLASFNIFIAFIMILVSYIIIFITISKMHSGAGFQKALS
TCVSHLTVVFIFYGTTIFMYLQPSSRHAMDADKMVSVFYTMVIPC