Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5b108 Olfactory Receptor

Gene Symbol Or5b108
Organism Mouse
Family 5
Subfamily b
Pseudo No
Location chr19:13190669-13191589 (+)
Aliases Olfr1462, MGC157634, MOR202-13

Sequence information


Nucleotide sequence

ATGGAGAACACGACAGAAGTGACATGGTTTGTCTTGCTGGGACTCACCAATGACCCACAA
CTCCAGCTTCCACTCTTCATTACCTTCCTCCTCATCTACATCATCACTCTGGTGGGGAAC
CTAGGGATTATCCTGTTGATTCTCTTGGACTCTAGGCTCCACACCCCCATGTACATTTTC
TTGAGTAACCTGTCCTTAGTGGACTTCTGTTATTCCTCAACAATCACTCCAAAGGTCATG
GCTGGATTTCTTACAGGAGATAGGATCATATCTTATAATGCTTGTGCCTCTCAGATGTTC
TTTTTTGCACACTTTGCTGATGTGGAGAGCTACCTTTTAGTGTCCATGGCCTATGATCAT
TATGTAGCAGTGTGTAAGCCCCTACATTATGCCACCACCATGACAACACACTTATGTGTT
TTTCTAGTTATTGGCTGTTACATTTGTGGTTTCCTGAATGCTTCCATCTATACAGTGGAT
GTATTTAGTCTCTCCTTCTGTGAGTCCAATGTCATTCATCATTTTTTCTGTGATGTTCTA
GCAGTCATGATAATATCTCGCTCTGACAAATATATTAATGAACTGGTTCTTATTTCTGTA
GCCAGTTTCAATATTATTTTTTCTCTTATACTCATCTTAATATCCTATATGTTCATTTTT
ACCAACATACTAAAGATAAACTCATCTGAAGGATATCGCAAAGCTCTCTCCACTTGTACC
TCACACTTTACAGCTGTCTTCATTTACTATGGGACTGTCATCTTCATGTACTTGCAGCCA
ACCTCCAGTCACTCCATGGACACTGACAAAATTGTGTCTGTGTTCTACTCCATTGTCATC
CCTATGTTGAACCCTCTGGTCTACAGCATGAGGAATAAGGAGGTGAAGAATGCATTCACA
AAGGTTGTATTGAGGTCAAGG


Conceptual translation

MENTTEVTWFVLLGLTNDPQLQLPLFITFLLIYIITLVGNLGIILLILLDSRLHTPMYIF
LSNLSLVDFCYSSTITPKVMAGFLTGDRIISYNACASQMFFFAHFADVESYLLVSMAYDH
YVAVCKPLHYATTMTTHLCVFLVIGCYICGFLNASIYTVDVFSLSFCESNVIHHFFCDVL
AVMIISRSDKYINELVLISVASFNIIFSLILILISYMFIFTNILKINSSEGYRKALSTCT
SHFTAVFIYYGTVIFMYLQPTSSHSMDTDKIVSVFYSIVIPMLNPLVYSMRNKEVKNAFT
KVVLRSR