Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5b109 Olfactory Receptor

Gene Symbol Or5b109
Organism Mouse
Family 5
Subfamily b
Pseudo No
Location chr19:13234252-13235181 (+)
Aliases Olfr1463, MOR202-29P

Sequence information


Nucleotide sequence

ATGACACCATTGAAAAACTGGACAGAAGTGACACACTTTCTCCTGCTGGGACTTACTGAT
GATCCAGGACTGCAGCTTCCCCTCTTCATCATTTTTCTCCTCATCTACATTTTCACCCTG
GTAGGGAACCTGGGGTTGATTCTGCTGATTCTTTTGGACTCTCGGCTCCACACTCCCATG
TACTTTTTTCTTGGTAACTTGTCTCTAGTTGATGTTTTTTACTCTTCAGCTATCACACCA
AAAGTCATGGCTGGGCTTCTATTGGGAGACAAGATCATATCCTACAATAGCTGTGCTGCT
CAGATGTTTGTTTTTGCAACCTTTGCTACTGTGGAAAATTACCTGTTGGCCTCAATGGCC
TATGATCGCTATGCAGCAGTATGTAAACCCTTACACTATGCTACTACCATGACTCCAAGT
GTATGTATGTGTCTGATCATGGGCTGCTATGTTCTTGGTTTTTTGAGTGTCTCAGTTTAC
CTTGGAGATACATTTAGTCTCTCTTTCTGTAAGTCTAATGTGGTCCATCATTTTTTTTGT
GACATGCCAGCACTCATGGCTCTCTCTTGCTCGGATAGGCATATCAATGAGCTAGTACTT
ATTTATCTAGCCAGCTTCACTCTCTTCTTTGCTCTCATAATAATATTAGTATCATATACT
ATAATTTTTATCACAATCTTAAACATGCACACAGGAGCAGGACTTCAGAAGGCTATTTCT
ACCTGTGCTTCCCACTTTATTGCTGTTTTTATTTTCTATGGAACAACAATCTTCATGTAT
TTGCAGCCAAGCTCTAGACATTCAATGGACACTGACAAAATTGTGTCTGTGTTCTATACC
ATGGTCATTCCCATGCTGAACCCTTTAGTTTACAGCCTGAGAAACAAAGAAGTCAAGAGT
GCATTCATGAAATGGATTCTGAAAGAAAAA


Conceptual translation

MTPLKNWTEVTHFLLLGLTDDPGLQLPLFIIFLLIYIFTLVGNLGLILLILLDSRLHTPM
YFFLGNLSLVDVFYSSAITPKVMAGLLLGDKIISYNSCAAQMFVFATFATVENYLLASMA
YDRYAAVCKPLHYATTMTPSVCMCLIMGCYVLGFLSVSVYLGDTFSLSFCKSNVVHHFFC
DMPALMALSCSDRHINELVLIYLASFTLFFALIIILVSYTIIFITILNMHTGAGLQKAIS
TCASHFIAVFIFYGTTIFMYLQPSSRHSMDTDKIVSVFYTMVIPMLNPLVYSLRNKEVKS
AFMKWILKEK