Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5b111 Olfactory Receptor

Gene Symbol Or5b111
Organism Mouse
Family 5
Subfamily b
Pseudo No
Location chr19:13313363-13314337 (-)
Aliases Olfr1465, MOR202-28

Sequence information


Nucleotide sequence

ATGTTTCTTTTTTCCAATGTCTATGAACAATTAAAACTTTTAAATGTAACAGTGATGGAG
AACAATACAGAAGTGACACACTTTCTCCTGCTTGGACTCACAGATGACCCAGAACTACAG
CTTCCCCTCTTCATGATACTTCTAATCATCTACACCATCACCCTGGTAGGAAATCTGGGG
AAAATTCTGCTGATTTTCCTGGACTCGTGTCTCCACACTCCCATGTACTTTTTTCTAGGT
AATCTGTCCCTGGTGGATTTTTGTTACTCCTCTGATGTCACACCCAAAGTCATGAGTGGG
CTCCTAAAAGGAGACAAGGTCATATCCTATAATGGGTGTGCTGCTCAGATGTTCTTTTTT
GTAGCCTTTGCTACAGTGGAAAATTTCCTGTTGGCCTCAATGGCATATGATCGCTATGCA
GCAGTGTGTAAGCCCTTGCACTATGCCACCACTATGACTTCAGGTGTGTGTGTGTGTCTT
TCTATAGGTTCCTATGCCTGTGGTTTCCTGATTGCCTCCATTCACATTGGGGACACCTTC
AATCTTTCTTTCTGTAGGTCTAATGTGGTCCATCACTTCTTTTGTGATATCCCAGCAGTC
ATGATTCTCTCTTGCTCTGATAGACATGTTAGTGAGCTGGTTCTTTTTTATGTAGGGAGC
TTCAGTATTTTTTTTTCTGTGTTAGTTATTTGTATATCCTACATATTCATTTTTATCACA
ATCTTTAAAATGCACTCAGATGCTGGATATGGAAAGGCTGTATCCACTTGTGCCGCACAC
TTCACTGCAGTGTCTATTTTCTATGGGACTGGCATATTCATGTATTTGCAGCCCAGCTCC
AGTCACTCCATGGACACTGACAAAATCACATCTGTGTTCTACACCATGATCATCCCTATG
CTGAATCCTCTGGTCTACAGCATGAGGAACAAAGAAGTCAAGCGTGCATTCACAAACGTT
TTCCACAAAGCAAAA


Conceptual translation

MFLFSNVYEQLKLLNVTVMENNTEVTHFLLLGLTDDPELQLPLFMILLIIYTITLVGNLG
KILLIFLDSCLHTPMYFFLGNLSLVDFCYSSDVTPKVMSGLLKGDKVISYNGCAAQMFFF
VAFATVENFLLASMAYDRYAAVCKPLHYATTMTSGVCVCLSIGSYACGFLIASIHIGDTF
NLSFCRSNVVHHFFCDIPAVMILSCSDRHVSELVLFYVGSFSIFFSVLVICISYIFIFIT
IFKMHSDAGYGKAVSTCAAHFTAVSIFYGTGIFMYLQPSSSHSMDTDKITSVFYTMIIPM
LNPLVYSMRNKEVKRAFTNVFHKAK