Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5b114-ps Olfactory Receptor

Gene Symbol Or5b114-ps
Organism Mouse
Family 5
Subfamily b
Pseudo Yes
Location chr19:13374964-13375885 (+)
Aliases Olfr1468-ps1, MOR202-21

Sequence information


Nucleotide sequence

ATGAAGAACAGCACAGAAGTGACACACTTTCTCCTGTTGGGACTCACCGATGACCCAGGA
CTACAGCTTCCCCTCTTCTTGATATTTCTCTTCATCTACACCATCACCCTTGTGGGAAAT
CTGGGTATGATCCTGCTGATAGTCCTGGACTCTCGTCTCCACACACCCATGTACTTTTTT
CTGTGTAATCTGTCCTTGGTGGATTTTTGTTACTCCTCAGCAGTCACACCCACAGTAATG
ACTGGGCTCCTAATAGGAAACAAGATCATTTCCTATAATGGGTGTGCTGCTCAGATGTTC
TTTTTTTGCTGGCTTTGCTACTGTGGAAAACTATCTGCTTGCCTCAATGGCCTATGATCG
CTATGCAGCAGTGTGTAAGCCACTACATTATTCCTCTACCATGACTACCAGTGTATGTAT
AAGTCTTTCTATAGTTTCCTATGCTTGTGGTTTTCTGAATGCCTCTATCCATATTGGGGA
CACTTTCATTCTTTCCTTCTGTAGGTCTAATGTAGTGCATCACTTTTTCTGTGATGTTCC
AGCTGTCATGGTTCTCTCTTGCTCTGATAGACATGTTAGTGAGCTGGTTCTTGTTTATAT
AGTGAGCTTCAATATCTTTGTTGCTCTCTCAGTTATTTGGATATCCTATATATTCATTTT
TATCACAATCTTTAAAATGAAATCAAGTGCTGGATATCGAAAGGCTATATCTACTTGTGC
CTCTCACTTCACTGCAGTGTCCATTTTCTACGGGACGATCATATTCATGTATTTGCAGCC
CAGCTCCAGTCACTCTATGGACACTGACAAAATCGCATCTGTGTTCTACACCATGGTCAT
CCCTATGCTGAACCCTCTGGTCTATGGCCTGAGGAACAAGGAAGTTAAGAGTGCATTCAT
AAAAACTTTTCAAGTGGCAAAA


Conceptual translation

MKNSTEVTHFLLLGLTDDPGLQLPLFLIFLFIYTITLVGNLGMILLIVLDSRLHTPMYFF
LCNLSLVDFCYSSAVTPTVMTGLLIGNKIISYNGCAAQMFFF\GFATVENYLLASMAYD
RYAAVCKPLHYSSTMTTSVCISLSIVSYACGFLNASIHIGDTFILSFCRSNVVHHFFCDV
PAVMVLSCSDRHVSELVLVYIVSFNIFVALSVIWISYIFIFITIFKMKSSAGYRKAISTC
ASHFTAVSIFYGTIIFMYLQPSSSHSMDTDKIASVFYTMVIPMLNPLVYGLRNKEVKSAF
IKTFQVAK