Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5b115-ps Olfactory Receptor

Gene Symbol Or5b115-ps
Organism Mouse
Family 5
Subfamily b
Pseudo Yes
Location chr19:13434089-13435095 (-)
Aliases Olfr1470-ps1, MOR202-30P

Sequence information


Nucleotide sequence

ATGAAGAAGAACATAGAAGAGAGTGAATTCATCCTCCTAGGACTAACCAAATCACCAGAG
CTTCAAGTTCTTCTTCTTATGATACTCACATTTATCTACGCCATCACTTTGACTGGAAAT
CTTGGAATGTTCCTTCTGATATTGCTGGATGCTCATCTACATACCCCCATGTACTTCTTC
CTTAGAAATCTGTCCTTGGTGGACTTGGGTCTTCCTCAACAGTCACTCCAAAGGTCATGG
CTGGACTCCTTACAGGAAGTAATGTAATTTCTTACAATACATATGCTGTTCTGATGTTCT
TCTTTGTATTCTTTGCCACTGTGGATAGCTACCTCTTAGCCTCATCTCAATGGCATATGA
TGGATATGCAGCAGTGTGTAAACCCTTACATTATACTACCACTATGACAAAAGGTGTCTG
TACTTGTCTGGCCATTAGTTCCTATATTTTTGGCATTTTGAATGCTTCTATACAAATATA
TATTTGGCCTCCCTTTCTGTGGATATAATGTGATTAATCACCTTTTCTGTGATATTCCTG
CAGTGAGAATTCTGGCTTGCTCTGATAAACATGTGAATGAGATGATTCTTATTCTTGTAT
CTAGCTTTCACATTATATTTGTTTTTCTTGTTATCTTGATTTCCTACTTACTCATATTTT
TGTACATTTTGAAGATGCATTCAAGTGAGGGATACCATAAGGCTTTTTCCACCTGTGCTT
CCCACGTCACTGCAGTTTTTACATTTTACGGAACTGTCACCATAGTGTACTTAAAGCCAA
GTGCCAATCATTCCATAGACACAGATAAATTTGTCTCTGTGATTTATACTATGGTCATTC
CCATGCTGAATCCTATGGTCTATAGCCTGACGAACAAAGAAGTTAAGAATGCATTAAAGA
ACATTTTTCAAAAGGCAAAGCTATATGTATATATGCTATATGTATGTAGTACCTTAATGA
TATCACTGATAAAATATTATTCCATTTCTCATTTTTTTGTTTTATTT


Conceptual translation

MKKNIEESEFILLGLTKSPELQVLLLMILTFIYAITLTGNLGMFLLILLDAHLHTPMYFF
LRNLSLVDLG/SSTVTPKVMAGLLTGSNVISYNTYAVLMFFFVFFATVDSYLLA/ISM
AYDGYAAVCKPLHYTTTMTKGVCTCLAISSYIFGILNASIQ\IFGLPFCGYNVINHLFC
DIPAVRILACSDKHVNEMILILVSSFHIIFVFLVILISYLLIFLYILKMHSSEGYHKAFS
TCASHVTAVFTFYGTVTIVYLKPSANHSIDTDKFVSVIYTMVIPMLNPMVYSLTNKEVKN
ALKNIFQKAKLYVYMLYVCSTLMISLIKYYSISHFFVLF