Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5b116 Olfactory Receptor

Gene Symbol Or5b116
Organism Rat
Family 5
Subfamily b
Pseudo No
Location chr1:230305923-230306864 (+)
Aliases Olr365, Olr365

Sequence information


Nucleotide sequence

ATGACTTTGATGGAAAATATTTCAGAGGTTACTGAATTTATTCTTGTAGGGTTAACAGAT
GCCCCAGAACTGCAGATCCCTTTGTTTATTATCTTCACTCTCATATATTTGATCACACTG
TTTGGAAATCTTGGGATGATAATGCTGATTCTGCTGGACTCCAGACTCCACACTCCCATG
TACTTTTTCCTCTGTAACCTCTCCCTGGTGGACTGTGTTTATGCCTCAGCAATAACCCCA
AAGGTGATGGAAGCTTTTTTCACAGGAAATAATACCATATCCTTCAATGGGTGTGCTGCT
CAGATGTTCTTCTTTGTAGCCTTTATTGCTATTGAAAGTTTGATCCTTGCCTCAATGGCA
TATGACCGTCATGCAGCAGTGTGCAAACCCCTGCATTACACTACCATCATGACAAGTACT
ACTTGTATTGTAATTGCCACTTGTTGCTACATGTGTGGAATCCTGCAATCCTCTATCCAT
GTTGCTCTTGCATTTCGTCTTTCCTTCTGTCATTCAAATATGATTAATCACTTTTTCTGT
GACATTCCCCCACTGTTGACTATTTCTTGTTCTGACACCCACACAAATGAAATCACCCTC
CTCATCTTGGCTACATTGGATGTTGTTTTCACTCTCTTGGTTATCTTAAACACATACCTG
CTAATTTTCATTGCTATCCTGAGGATGCGTTCAGCTGAAGCACAGAGGAAGGCTTTCTCT
ACCTGTGCTTCCCATCTTATCACTGTGTCCATCTTCTTTGGTTCACTTACATTCATGTAT
TTACAGCCCAGTTCCAGTCACTCAATGGATACAGACAAAATTGCATCTGTTTTTTATACA
ATGGTTATTCCTATGTTGAACCCTTTGGTCTACAGCTTGAGGAACAAAGAAGTCAAAAAT
GCATTTAAGAAGGTTGTTGGAAAATTAATGTCTTCATTTAGC


Conceptual translation

MTLMENISEVTEFILVGLTDAPELQIPLFIIFTLIYLITLFGNLGMIMLILLDSRLHTPM
YFFLCNLSLVDCVYASAITPKVMEAFFTGNNTISFNGCAAQMFFFVAFIAIESLILASMA
YDRHAAVCKPLHYTTIMTSTTCIVIATCCYMCGILQSSIHVALAFRLSFCHSNMINHFFC
DIPPLLTISCSDTHTNEITLLILATLDVVFTLLVILNTYLLIFIAILRMRSAEAQRKAFS
TCASHLITVSIFFGSLTFMYLQPSSSHSMDTDKIASVFYTMVIPMLNPLVYSLRNKEVKN
AFKKVVGKLMSSFS