Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5b118 Olfactory Receptor

Gene Symbol Or5b118
Organism Mouse
Family 5
Subfamily b
Pseudo No
Location chr19:13470972-13471913 (+)
Aliases Olfr1474, MOR202-26P, MOR202-42

Sequence information


Nucleotide sequence

ATGGAGAATATTTCAGAGGTTACTGAATTTATTCTTGTAGGCTTGACAGATGCCCCAGAG
CTTCAGATTCCTTTGTTTATTATCTTCACTCTCATTTATTTGATTGCACTGTTTGGGAAT
CTTGGGATGATCATACTGATTCTGCTGGACTCCCGACTCCACACTCCCATGTACTTTTTC
CTCTGTAATCTCTCGGTGGTGGACTGTGTTTATGCCTCAGCAATCACCCCCAAGGTGATA
GAAGGGTTTCTCACAGGAAGTAAGACCATATCATTAAATGGGTGTGCTGCCCAGATGTTC
TTCTTTGTAGCCTTTGGTGCTATTGAAAGTTTGATCCTTGCCTCAATGGCCTATGACCGT
CATGCAGCAGTGTGCAAACCCCTGCACTATACTACCATTATGACAAGTACCACCTGCATT
CTAATTGTCACTTGGTGCTACACTTGTGGGATCTTACAATCTTCTGTCCATGTTGCTCTG
GCATTTTCTCTTTCCTTCTGTCATTCCAACGTAATTAATCACTTTTTCTGTGACATTCCC
CCACTGCTAGACATTTCTTGTTCTGACACCCACACAAATGAGATTACACTGCTCGTCTTG
GCTACATTAGATCTTGTTTTCACTCTCTTGGTTATCTTAAACACTTACCTGCTTATTTTC
ATTGCTATCCTGAGGATGCGTTCAGCTGAAGCACAGAGGAAGGCCTTCTCTACCTGTGCA
TCTCATCTCATCACTGTGTCTATCTTCTTTGGTTCCCTTATATTCATGTACTTACAGCCC
AGTTCCAATCATTCCATGGACACAGACAAAATTGCATCTGTGTTTTATACAATGGTCATT
CCTATGCTGAACCCTGTGGTCTACAGCCTGAGGAACAAAGAGGTAAAAAATGCATTTAAG
AAAGTTGTTGAAAGATTAATGTCTTCATTTCATTTAGTCCAT


Conceptual translation

MENISEVTEFILVGLTDAPELQIPLFIIFTLIYLIALFGNLGMIILILLDSRLHTPMYFF
LCNLSVVDCVYASAITPKVIEGFLTGSKTISLNGCAAQMFFFVAFGAIESLILASMAYDR
HAAVCKPLHYTTIMTSTTCILIVTWCYTCGILQSSVHVALAFSLSFCHSNVINHFFCDIP
PLLDISCSDTHTNEITLLVLATLDLVFTLLVILNTYLLIFIAILRMRSAEAQRKAFSTCA
SHLITVSIFFGSLIFMYLQPSSNHSMDTDKIASVFYTMVIPMLNPVVYSLRNKEVKNAFK
KVVERLMSSFHLVH