Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5b119 Olfactory Receptor

Gene Symbol Or5b119
Organism Mouse
Family 5
Subfamily b
Pseudo No
Location chr19:13479255-13480325 (-)
Aliases Olfr1475, MOR202-36

Sequence information


Nucleotide sequence

ATGCATTTAATCATCTTATATAAAGTGTATTTCTCAGGAAAAAAATGTTTAAAGTTTACA
ATTCCATTGACATTAGCATATTCTTTCTTTATTCTAGGAACTTGTTATGATAATTGCCAA
ATAACTTTGATGGAGAATATTTCAGAGGTTACTGAATTTATTCTCATGGGGATAACAGAT
GCCCCAGAGCTTCAGATTCCTTTGTTTATTATCTTCACTCTCATTTATTTGATCGCACTG
TTTGGAAATCTTGGGATGATCATGTTGATTCTGCTAGATTCCCGACTCCACTCTCCCATG
TACTTTTTCCTCTGTAACCTCTCCCTGGTGGACTGTGTTTATGCCTCAGCTGTCACTCCC
AAGGTGATGGAAGGGTTTCTCACAGGAAATAAGATAATATCCTACAATGCATGTGCTGCC
CAGATGTTCTTCTTTGTAGCCTTTGGTGCTATTGAAAGTTTGATCCTTGCCTCAATGGCC
TATGACCGTCATGCAGCAGTGTGCAAACCCCTGCACTATACTACCATTATGACAAGTACC
ACCTGTATTCTAATTGTCACTTGCTGCTACATGTGTGGGATCTTACAATCCTCTATTCAT
GTTGCTCTTGCATTTTGTCTTTCCTTCTGTAATTCCAACGTGATTAATCACTTTTTCTGT
GACATTCCCCCACTGCTGGACATCTCTTGTTCTGATACCTACACAAATGAGATTACAGTC
CTTATCTTGGGTACTTGTGATGGTATTTTAACTCTCTTGGTTATCTTAAACACTTACTTG
CTTATTTTCATTGCTATCCTGAGAATGCGTTCAGCTGAAGCACAGAGGAAGGCATTCTCT
ACCTGTGCATCTCATCTCATCACTGTATTCATCTTCTTTGGGTCAACCTTGTTCATGTAT
TTACAGCCCAGTTCTAATCATTCCATGGACACAGACAAAATTGCATCTGTGTTTTACACC
ATGGTGATTCCTATGCTGAACCCTGTAGTATACAGTTTAAGGAACAAGGAGGTAAAAAAT
GCATTTAAGAAGGTTGTTGGAAAATTAATGACTTCACTTCAGTTAGTCAAT


Conceptual translation

MHLIILYKVYFSGKKCLKFTIPLTLAYSFFILGTCYDNCQITLMENISEVTEFILMGITD
APELQIPLFIIFTLIYLIALFGNLGMIMLILLDSRLHSPMYFFLCNLSLVDCVYASAVTP
KVMEGFLTGNKIISYNACAAQMFFFVAFGAIESLILASMAYDRHAAVCKPLHYTTIMTST
TCILIVTCCYMCGILQSSIHVALAFCLSFCNSNVINHFFCDIPPLLDISCSDTYTNEITV
LILGTCDGILTLLVILNTYLLIFIAILRMRSAEAQRKAFSTCASHLITVFIFFGSTLFMY
LQPSSNHSMDTDKIASVFYTMVIPMLNPVVYSLRNKEVKNAFKKVVGKLMTSLQLVN