Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5b12 Olfactory Receptor

Gene Symbol Or5b12
Organism Mouse
Family 5
Subfamily b
Pseudo No
Location chr19:12,919,400-12,920,300 (-)
Aliases Olfr1448

Sequence information


Nucleotide sequence

MENSTEVTEFILAGLTDDPKLQIPLFIVFLLIYLSTVLGNLGMVGLILLDSHLHTPMYLF
LSHLSLVDFGYSSAVTPKVMSGLLSIDKTISHNTCGTQFFFFVGFITTESFLLAAMAYDR
YAAVCKPLHYTTTMTTNTCACLTIGSYVCGFLNSSIHTGNIFRLSFCKFNVIDHFFCDAP
PLLALSCSDTYISETVIFFVVGFNALFSIVVITISYLLIFITILRMRSSEGRHKAFSTCA
SHLTAVSIFYGTVIFMYLQPSSSHTMGTDKMASVFYTMVIPMLNPLVYSLRNKEVKGAFK
KAVGNAKSALTFLF


Conceptual translation

MENSTEVTEFILAGLTDDPKLQIPLFIVFLLIYLSTVLGNLGMVGLILLDSHLHTPMYLF
LSHLSLVDFGYSSAVTPKVMSGLLSIDKTISHNTCGTQFFFFVGFITTESFLLAAMAYDR
YAAVCKPLHYTTTMTTNTCACLTIGSYVCGFLNSSIHTGNIFRLSFCKFNVIDHFFCDAP
PLLALSCSDTYISETVIFFVVGFNALFSIVVITISYLLIFITILRMRSSEGRHKAFSTCA
SHLTAVSIFYGTVIFMYLQPSSSHTMGTDKMASVFYTMVIPMLNPLVYSLRNKEVKGAFK
KAVGNAKSALTFLF