Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5b121 Olfactory Receptor

Gene Symbol Or5b121
Organism Mouse
Family 5
Subfamily b
Pseudo No
Location chr19:13529612-13530619 (+)
Aliases Olfr1480, MOR202-44

Sequence information


Nucleotide sequence

ATGTCCAAATACAATATTTTTTTTTATTTCATCCTAGGAGTCTGCTTTAATTCCCATATA
AAAATGATTCAGAATATTTCAGAACTGTCTGAATTTATTCTTGTTGGGTTAACAGATGCA
CCACTCCTGCAAACTCCTTTATTTATCATCTTTACTCTCACTTACTTGACAACATTGTTT
GGGAATCTTGGGATGATTTTGCTGATTCTGCTGGACTCCCGACTCCACACTCCAATGTAC
TTTTTCCTCAGTAACCTCTCTCTGGTGGACTGTGTTTATGCCTCAGCTGTCACCCCCAAG
GTGATGGAAGGGTTTCTCATAGAAAATAAGATCATATCCTACAATGCATGTGCTGCCCAG
ATGTTCTTCTTTGTAGCCTTTGTTATTACGGAGAGTTTTATCCTGGCCTCAATGGCCTAT
GACCGTTATGCAGCAGTGTGCAAACCCTTGCATTACTCCACTACTATGACAACTATGATA
TGTGTCCTGCTTCTTGCTGGATCTTATGTCAGTGGACTCTTACAATCTTCCATTCATGTT
TCCTTCACATTTCAACTCTCCTTCTGCCATTCTAATGTAGTCAATCACTTTTTCTGTGAT
ATCCCCCCACTATTAGCTCTTTCTTGCTCCAGTATTTACACAAATGAAATTATACTCTTT
ATGTTGGCAGCATTCAATGTTGCTTTTACTCTATTAGTTATATTGTCCTCTTACTTACTA
ATTTTTGTTGCAATTCTGAAAATGCGCTCTGCTGAGAGCAGGAAGAAGACCATTTCCACC
TGTGCATCCCACCTTACCACTGTTTCCATCTTCTATGGAACAATTATCTTCATGTACTTA
CAACCCAGCTCCAATCACTCCATGGACACTGACAAGTTGGCATCTGTTTTCTACACCATG
GTCATTCCCATGCTGAACCCTCTTGTATATAGCCTGAGAAATAAAGAAGTCAAGAATGCA
TTCAAGAAAGTTGCTGGAAAAGCAGTGCTTTCACTGGGATTAGTCAAT


Conceptual translation

MSKYNIFFYFILGVCFNSHIKMIQNISELSEFILVGLTDAPLLQTPLFIIFTLTYLTTLF
GNLGMILLILLDSRLHTPMYFFLSNLSLVDCVYASAVTPKVMEGFLIENKIISYNACAAQ
MFFFVAFVITESFILASMAYDRYAAVCKPLHYSTTMTTMICVLLLAGSYVSGLLQSSIHV
SFTFQLSFCHSNVVNHFFCDIPPLLALSCSSIYTNEIILFMLAAFNVAFTLLVILSSYLL
IFVAILKMRSAESRKKTISTCASHLTTVSIFYGTIIFMYLQPSSNHSMDTDKLASVFYTM
VIPMLNPLVYSLRNKEVKNAFKKVAGKAVLSLGLVN