Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5b123b Olfactory Receptor

Gene Symbol Or5b123b
Organism Rat
Family 5
Subfamily b
Pseudo No
Location chr1:230,057,000-230,058,000 (+)
Aliases Olr357

Sequence information


Nucleotide sequence

ATGATGCAGAATAATTCAGAACTGACTGAATTTATTCTTGTTGGGTTAACAGATGTTCAA
TTTCTGCAAGTTCCTTTATTTATTATCTTCACTCTCATTTATTTGACCACATTGGTTGGG
AATCTTGGGATGATTTTGTTGATTATCTTGGACTCCAGACTACACACTCCCATGTACTTT
TTCCTCAGTAACCTCTCCTTTGCAGACTGTGTTTATGCCTCAGCTGTCACTCCCAAGGTA
ATAGAAGGGTTTCTCACAGAAGATAAGATCATATCCTACAATGCATGTGCTGCTCAAATG
TTCTTCTTTGGAGTCTTTGCTATTATTGAGAGTTTTCTCCTGGCCTCAATGGCATATGAC
TGTCATGCAGCAGTGTGCAAACCCTTGCATTATTCCACCACCATGACAACTATGATATGT
TCCCTGCTTCTTGCTGGATCATACGTCAGTGGAATCTTACAATCTTCCATCCATGTTGCT
TTCACTTTCCATCTTTCCTTCTGTCATTCCAATGTGGTAAATCACTTTTTCTGTGATATT
CCCCCACTATTATCTCTTTCTTGCTCCAGTATTTACACAAATGAAATTGTACTGTTCATG
TTGGCAGCATTCGATGTTGGTTTTACTCTGTTGGTTATCTTGACTTCTTACTTACTCATT
TTTGTTGCAATTCTGAGAATGAACTCTGCTGAGAGCCGGAAGAAGGCCATTTCCACCTGT
TCTTCCCACCTTACCACAGTTTCCATTTTCTATGGCACAATTATCTTCATGTACTTACAG
CCCAGCTCCAGTCACTCCATGGACACTGACAAAATGGCATCTGTGTTCTACACTATGGTC
ATCCCCATGCTGAACCCTATTGTATACAGTCTGAGAAATAAAGAAGTCAAGAATGCATTC
AAGAAGGTTGCTAGAAAAGCTTTGTCTTCACTGGGATTAGTCAAT


Conceptual translation

MMQNNSELTEFILVGLTDVQFLQVPLFIIFTLIYLTTLVGNLGMILLIILDSRLHTPMYF
FLSNLSFADCVYASAVTPKVIEGFLTEDKIISYNACAAQMFFFGVFAIIESFLLASMAYD
CHAAVCKPLHYSTTMTTMICSLLLAGSYVSGILQSSIHVAFTFHLSFCHSNVVNHFFCDI
PPLLSLSCSSIYTNEIVLFMLAAFDVGFTLLVILTSYLLIFVAILRMNSAESRKKAISTC
SSHLTTVSIFYGTIIFMYLQPSSSHSMDTDKMASVFYTMVIPMLNPIVYSLRNKEVKNAF
KKVARKALSSLGLVN