Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5b124b-ps Olfactory Receptor

Gene Symbol Or5b124b-ps
Organism Rat
Family 5
Subfamily b
Pseudo Yes
Location chr1:230351873-230353013 (+)
Aliases Olr366-ps, Olr366-ps

Sequence information


Nucleotide sequence

CTTAATCATACCTAAAATCTCAAAGTGAGTTCCATATTCAATATTTTTTTAATTTCCTGA
TTTCATCCTAGGAGACTGTCATAATTTACATGAAACAAAGATGAAGAATATTTCAGAAAT
CACTGAATTTATCCTTGTGGGATTAACATTTGTCCCAGAACTACAGATTCCTTTATGTAT
CATCTTCACTTTTATTTATTTGACCACATTGATTGGTAATCTTGGGATGATTGGGTTGAT
TCTCCTGGATTCTCGTCTCCACACTCCCATGTACTTTTTTCTCAGTAACCTCTCACTAGT
GGACTGTGTTTATGCCTCAGCTGTCACTCCCAAAGTGATAGAAGGCTTTCTCACAGAAAA
CAACATCATATCCTACAATGCATGTGCTACCCAGATGTTCTTTTTCATAGCGTTTGCAAT
TACTGAAAGTTTTCTATTGGCATCTATGGCCTTTGATCGTCATGCAGCAGTGTGCAAACC
CTTACACTACTCTACCACCATGACAACAACAATATGTACCCTGCTTATTGCAGGTTCTTA
CATAATTGGATTTTTACAATCTTCCATTCATGTTGCCTTCACATTCCACCTATCCTTTTG
CCATTCTAATATAGTGAATCATTTTTTTGTGACATTCCCCCACTACTGGATCTTTCTTGC
TCTAGTATCTACACAAATGAAATTGTATTGTTCATTTTGGCAGGACTCAATGTTGCTTTA
AGTGTGTTGGTTATCTTGAATTCTTACATACTTATTTTTGTTGCAATCATGAGAATGCGT
TCTGCTGATGGACAAAAGAAGGCCATTTCCACATGTGCTTCACACCTGACCACTGTTTCC
ATATTCTATGGCACGATCATCTTCATGTACTTACAGCCCAGCTCCACTCACTCCATGGAC
ACTGACAAGGTAGCATCTGTATTCTATACCATGATCATTCCCATGTTGAACCCTATAATC
TATAGCCTGAGGAACACAGAGGTCAAGAATGCATTCAAAAATGTTACTAGAAAAGTGTTG
TTTTCACTGGGTTTAGTCTAAGTGTAACATGTTTGTAAATTATGAAAACTTTTGAAGTAT
ATTGTCTTTAAATATTTTATACATTATTCTTCATAACATTAATCTTTGTGAATTGGTATT
T


Conceptual translation

MKNISEITEFILVGLTFVPELQIPLCIIFTFIYLTTLIGNLGMIGLILLDSRLHTPMYFF
LSNLSLVDCVYASAVTPKVIEGFLTENNIISYNACATQMFFFIAFAITESFLLASMAFDR
HAAVCKPLHYSTTMTTTICTLLIAGSYIIGFLQSSIHVAFTFHLSFCHSNIVN/FFCDI
PPLLDLSCSSIYTNEIVLFILAGLNVALSVLVILNSYILIFVAIMRMRSADGQKKAISTC
ASHLTTVSIFYGTIIFMYLQPSSTHSMDTDKVASVFYTMIIPMLNPIIYSLRNTEVKNAF
KNVTRKVLFSL