Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5b124c-ps Olfactory Receptor

Gene Symbol Or5b124c-ps
Organism Rat
Family 5
Subfamily b
Pseudo Yes
Location chr1:230415322-230415849 (+)
Aliases Olr369-ps, Olr369-ps

Sequence information


Nucleotide sequence

ATGCACAATATTTCAGGAGTCACTGAATTTATCCTTGTGGGATTAACAGATGCCCCAGAG
CTACAGATTCCTTTATGTATCATCTTCACTTTTATTTATCTGACCACATTGATTGGTAAT
CTTGGGATGATTGGGTTGATTCTCCTGGATTCTCGTCTCCACACTCCCATGTACTTTTTT
CTCAGTAACCTCTCACTGGTGGACTGTGTTTATGCCTCAGCTGTCACTCCCAAAGTAATA
GAAGGGTTTCTCACAGAAAACAACATCATATCCTACAATGCATGTGCTACCCAGATGTTC
TTCTTCATAGCATTTGCAATTACTGAAAGTTTTCTCTTAGTATCTATGGCCTTTGATCGT
CATGCAGCAGTATGCAAACCCTTGCATTACTCTACCACCATGACAACAACAATATGCACC
CTACTTATTGCTGGTTCTTACATAATTGGATTTTTACAATCTTCCATTCATGTTGCCTTC
ACATTCCACCTATCCTTTTGCCATTCCAACAGAGTGAATCATTTTTTT


Conceptual translation

MHNISGVTEFILVGLTDAPELQIPLCIIFTFIYLTTLIGNLGMIGLILLDSRLHTPMYFF
LSNLSLVDCVYASAVTPKVIEGFLTENNIISYNACATQMFFFIAFAITESFLLVSMAFDR
HAAVCKPLHYSTTMTTTICTLLIAGSYIIGFLQSSIHVAFTFHLSFCHSNRVNHFF\DI
PPLLDLSCSSIYTNEIVLFILAGLSVALSVLVILNSYILIFVAIMRMRSADGQKKAISTC
ASHLTTVSIFYGTIIFMYLQPKSTHSMDTDKVASVFYTMIIPMLNPIIYSLRNTEVKNAF
KNVTRKVLFSL