Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5b126-ps Olfactory Receptor

Gene Symbol Or5b126-ps
Organism Rat
Family 5
Subfamily b
Pseudo Yes
Location chr1:229961147-229962278 (-)
Aliases Olr350-ps, Olr350-ps

Sequence information


Nucleotide sequence

TACCCACACTTATGTATTTCTATTTTAATTCAACTTTGTTATCCTTGTGTTTTTCTTTTC
CAATAGATGTGAACATTCTAATGATTTAAAGGTAGAAAAGATGGAGAATAATACAGAAGT
GACAGAGTTTCTCCTGCTGGGTCTCACCAGTGACCCAGTATTACAGCTTCCCCTATTCAT
ATTTCTTCTCATCTATACCATCACACTGGTGGGAAATCCGGAGATAATCCTGGTGATTTT
ACTCAACTTTTGTCTCCACAGTACCATGTACTTTTTTCTAGATAATCTGTCTTTGGTTGA
TTTTTGTTACTCCTCAGCTGTCATCCCAAACTCATGACTAGGCTCCTTATAAGAAACGAG
GACATTTCCTATAATGACTGTGCTGCTCAGATGTTCTATTTTGTAGCCTTTACTAGTGTG
GAAAATTACCTGTTGGCCTCAATGGCCTACGATCGCTATGCAGCAGTATATAAGCACTTG
CACTATGCTACCACCATGACTTCAAGTGTGTCTGGCTTTCTATAGGTTCCTATGTATGTG
ATTTCCTGAATGCATTCATTCACATTGGAGATACTTTCAGTTTTTCCTTCTGTAGATCTA
ATATTGTCCATCATTTCTTCTGTTCCAGCAGTCATAGTTCTCTCTTGCTTTGACAGACAC
AACAGTGAGTTGGTTCTTGTTTATGTAGGAAGCTTCAATATATTTTTTGCCCCCTTAGTT
ATTTGTATATCCTACACATTCATTTTTATTACAATCTTTAAAATGCACTCAAGTGCTGAA
TATGGAAAGGCTGTATCCACTTATGCCTCACACTTCACTGCAGTGTCTATTTTCTATGGG
ACAGTCATATTCATGTACTTGCTGCCTAGCTCCAGTCACTCCATGGACACTGACCCAATC
GCATCAGTATTCTACACCATGATCATCCCTATGCTGAACCCTCTAGTCTACAGTCTGCAG
AACAAAGAAGTCAAAAGTGCATTCACAACAATTTTTCAGGTGGCAAAATGGCCTGTAGTG
CTTTATTTTTAATGTTGAAGGATAAATAATATTTATTATTTTCTGCTACATGCAATTAAT
TTCCAGAATGGATTCTCATATTTCTGTAGTTCTAAGGTGTAGAGGTATAGAA


Conceptual translation

MVEKMENNTEVTEFLLLGLTSDPVLQLPLFIFLLIYTITLVGNPEIILVILLNFCLHSTM
YFFLDNLSLVDFCYSSAV/PKLMTRLLIRNEDISYNDCAAQMFYFVAFTSVENYLLASM
AYDRYAAVYKHLHYATTMTS/CVWLSIGSYVCDFLNAFIHIGDTFSFSFCRSNIVHHFF
CS\VIVLSCFDRHNSELVLVYVGSFNIFFAPLVICISYTFIFITIFKMHSSAEYGKAVS
TYASHFTAVSIFYGTVIFMYLLPSSSHSMDTDPIASVFYTMIIPMLNPLVYSLQNKEVKS
AFTTIFQVAKWPVVL