Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5b127-ps Olfactory Receptor

Gene Symbol Or5b127-ps
Organism Rat
Family 5
Subfamily b
Pseudo Yes
Location chr1:230093370-230094527 (-)
Aliases Olr359-ps, Olr359-ps

Sequence information


Nucleotide sequence

TGGAAAACCAGAATGTCTAACCACTAAACCATCTCTAGAATACCCGTTTTACTCTTTTTT
AAAAAACTTAAAGCCTTCGGTTGATTAACTGATATCATTAATGGAGAACAGGACAGAATT
GATATCGTTCATCCTGATGGGACTCAGTGATGATCCAAGTCTGCAGCTTCCCCTCTTCAT
CACCTTCCTCCTCATCTACATCATCAGGTTGGTTGTAAACCTGGGGATGATACTTTTGAT
ATTCTTGGACTCTTGACTCCAAATCCCTATGTACATTCTCCTAAGTAATCTGTTCTTGGT
GAACTTCAGTTACTCTTCAACAATCACTCCAAAGATCATGGCTGGAATTTTTACAGTAGA
CAAGATCATGTCCCACAATGCTTGTGCCTCTCAGATGTTCTTTTTTGCAAACTTTGCCAA
TGTGGAAAACTACCTTTTAGTCTCAATCACATATGATTGTTATGAAGCAGTGTGTAAACC
CCTACATTATGCCACCACCATGACAACACAAGTGTATGCTTGCCTAGTCATTGGTTGTTA
CTTCTGTTGTTTCCTGAATACTTCTATCTATACATTGAATGCATTAAGTTTCTCTCTCTG
TTGGTTAAATGTGATCCACCATTTTTTCTGTGACATTCCATGATTATATCGTGTACTGAT
AGACATGATTATATCGTGTACTGATAGACATGATTATATCGTGTACTGATAGACATGTTA
ATGATCTGGTTCTTAAGTCTGTAGCCAGCTTCAACATCTTTTCTGCTCTTATACTTATGT
TAAAATTCTTCATGTTCATTTTTACCAATATATTAAAGATGCACTCAACTTCAGGATGTC
ACAAAACTCTCACTCCTTGTGCTTCACACTTTATAGCTGTCTTGATTTTCTATGGGATAA
TCATACTCATGTCCTTGCAGCCCAACTCCAGTCACTCCATGGACACTGGCAAAATTGCAT
CTGTGTTCTACACCATGGTCATTCCCATGTTGAATCTGCTGGTTTACAGCCTGAGGAACA
AGGATGTAAAAAAAGTACATTCACAAAAAATGTATTGAGGTCAAGATAATATTTACAGCT
TTGATTTTAAATTTTGGGAAGTCAAATCTACTAGATTCTTTGATTTAATCTTAAATATAT
ATCGAATTATATTTTCCA


Conceptual translation

MENRTELISFILMGLSDDPSLQLPLFITFLLIYIIRLVVNLGMILLIFLDS*LQIPMYIL
LSNLFLVNFSYSSTITPKIMAGIFTVDKIMSHNACASQMFFFANFANVENYLLVSITYDC
YEAVCKPLHYATTMTTQVYACLVIGCYFCCFLNTSIYTLNALSFSLCWLNVIHHFFCDIP
*LY\Y**T*LYRVLIDMIISCTDRHVNDLVLKSVASFNIFSALILMLKFFMFIFTNILK
MHSTSGCHKTLTPCASHFIAVLIFYGIIILMSLQPNSSHSMDTGKIASVFYTMVIPMLNL
LVYSLRNKDVKKVHSQKMY