Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5b128-ps Olfactory Receptor

Gene Symbol Or5b128-ps
Organism Rat
Family 5
Subfamily b
Pseudo Yes
Location chr1:230035630-230036711 (+)
Aliases Olr355-ps, Olr355-ps

Sequence information


Nucleotide sequence

GTAAAAGTCCATGCTTAAAGTTTAGTTGATATTTAAATAGCATAATTCATTATTTGCCTT
AGGAATATGTTGTAATAATTCCCTAATGACTTTGAAGTAGAATATTGCAGAGATTACTTA
ATTTAATCTTTTGGGATTTACAGATCCTCCAGAGCTTCAGATCCATTTGTTTTATGTCTT
CATTCTCATTTACTTGATCATACTGTTTGGGAATCCTGGGATGATAATAATGATTCTTCT
GGACTTCCGACTCAACACTCCCATGTACTTTTTTCTCTATAACCTCTCCCTGATGGACTG
TGTTTATGCCTCAGTGATTAGCCCTAGAAGATGGAAAGGTTTCTCACAGGAAAAAGGCCA
TATCCTTCAATGGGTGTGCTGCCCAGATGTTCTGATTTTTAGCCTTTATTGCTTTTCAAA
GTTTGATCCTCTCCTCATTGGTCTATAGCATCTTTCAGCAGTGGGCAAACCCCTGAACTA
CACTACCAGCATGACAAGTACCACTTGTATTCTAATTGTCACCTGGTGCTACATGTGGAA
TCTTGCAATCCTCTATCCATGTTGCTCTTGCATTTCACCTATTCTCTCACTCTAATGTCA
TTAACCACATTTTCTGTGACATTCCCCGATGTGGAAGATTTCTTGTTCTGACACCCACAC
AAATAAAATTTCACTCCTTATTTAGGCTACAATGGATGTTGTTTTTACTCTCTTAGTTAT
GTTAAACACATACCTGCTTATTTTCATTGCTATCCTGAGGATGCATTTAGCTGAAGCACA
GAGGAAGGACTCCTTTACCTGTGCATCCTATCTCATTACTGTGTCCATCTTCTTTGTTTC
CCTTATATTCACGTATTTACAGCCCAGCTCTAGTCACTCCATGGACACAGATTAAATTGC
ATCTGTGTTTTAAACAATGGTCATTCCTTTGCTGAAACATGTAGTATACAGCTTAAAGAA
CAAGGAGGTAAAATGCATTTAATTAAGTTATTGGAAAATTAATGTCTTCACTTGATTTAA
TCAATTAATTCCAAATTATTTTTAATTATTTAAAATACTGGATTTCGATTTTTCTTGAAT
AG


Conceptual translation

NIAEIT*FNLLGFTDPPELQIHLFYVFILIYLIILFGNPGMIIMILLDFRLNTPMYFFLY
NLSLMDCVYASVISPR/MERF/HRKKAISFNGCAAQMF*FLAFIAFQSLILSSLVYSI
/SAVGKPLNYTTSMTSTTCILIVTWCY\GILQSSIHVALAFHLFSHSNVINHIFCDI/br/>PPMWKISCSDTHTNKISLLI*ATMDVVFTLLVMLNTYLLIFIAILRMHLAEAQRKDSFTC
ASYLITVSIFFVSLIFTYLQPSSSHSMDTD*IASVF*TMVIPLLKHVVYSLKNKEVKCI