Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5b12b Olfactory Receptor

Gene Symbol Or5b12b
Organism Mouse
Family 5
Subfamily b
Pseudo No
Location chr19:12883883-12884824 (+)
Aliases Olfr1445, MOR202-7, MOR202-7

Sequence information


Nucleotide sequence

ATGGAGAATAGTACAGAGGTGACTGAGTTCATTCTCACAGGGTTAACAGATAACCCAGAG
CTCCAGATACCACTCTTCATTGTCTTCCTTCTCATCTATCTCAGCACTGTGCTTGGGAAC
CTGGGAATGGTAGGGTTGATCCTGCTGGACTCACATCTCCACACTCCCATGTACCTTTTC
CTCAGTCATCTATCTCTGGTGGACTTTGGTTATTCTTCAGCTGTCACTCCCAAAGTAATG
CCAGGTCTCCTTTCAATAGACAAAACCATAACACACAATGCTTGTGGCACCCAATTCTTC
TTCTTTGTAAGCTTTATAACTACAGAAAGCTTCCTCTTGGCTGCCATGGCTTATGACCGC
TATGCAGCAGTATGTAAGCCACTGCAGTACACCACCACCATGACTACAAACACTTGTGCT
TGTCTGACCATAGGTTCCTATGTCTGTGGCGTCCTGAATTCCTCTATCCACACTGGGAAC
ATTTTCAGGCTTTCTTTCTGCAAGTTCAATGTGATAGACCACTTTTTCTGTGATGCACCA
CCTCTCCTGGCCCTATCATGTTCAGACACTTCTGTCAGTGAGATGGTGATTTTATTTGTG
GTGGGTTTCAATGATATCTTCTCTATTGTGGTCATCCCGATATCCTATCTGTTTATATTC
ATCACTATTCTGAGGATGCGTTCATCTGAAGGACGCCAGAAGGCCTTTTCCACATGTGCT
TCCCACCTCACAGTAGTCTTCATCTTTTATGGATCAGGCATCTTCATGTACTTGCAGCCT
AGTTCCAGTCACACCATGGGCACTGACAAGATGGCATCTGTGTTCTATACCATGATCATC
CCCATGCTGAACCCTTTGGTCTACAGCCTGAGAAACAAAGAGGTCAAGAGTGCATTCAAA
AAGGCTGTGGAGAAAGCCAAAATTTCTCTAGCATTCACATTT


Conceptual translation

MENSTEVTEFILTGLTDNPELQIPLFIVFLLIYLSTVLGNLGMVGLILLDSHLHTPMYLF
LSHLSLVDFGYSSAVTPKVMPGLLSIDKTITHNACGTQFFFFVSFITTESFLLAAMAYDR
YAAVCKPLQYTTTMTTNTCACLTIGSYVCGVLNSSIHTGNIFRLSFCKFNVIDHFFCDAP
PLLALSCSDTSVSEMVILFVVGFNDIFSIVVIPISYLFIFITILRMRSSEGRQKAFSTCA
SHLTVVFIFYGSGIFMYLQPSSSHTMGTDKMASVFYTMIIPMLNPLVYSLRNKEVKSAFK
KAVEKAKISLAFTF