Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5b130-ps Olfactory Receptor

Gene Symbol Or5b130-ps
Organism Rat
Family 5
Subfamily b
Pseudo Yes
Location chr1:230,434,000-230,434,000 (+)
Aliases Olr370-ps

Sequence information


Nucleotide sequence

TCTTGCTCAAGTATTTACACAAATGAAATCATACTATTCATGTTGACAGCATTCAATGTT
GGCTTTACTCTATTCATTATCTTGACTTCTTACTTACTCATTTTTGTTGCAATTCTGAGA
ATGAACTCTGCTGAGAGCCAAAAGAAGGCCATTTCCACCTGTGCATCCCACCTTACCACT
GTTTCAATTTTCTACTTACAGCCCAGCTCAAGGCACTCCATGGACACTGACAAAATGGCA
TCTGTGTTCTACACCATGGTCATCCCCATGCTGAACCCTCTAGTATACAGCCTGAGAAAT
AAAGAAGTCAGGAATGCATTCAAGAAGATTTCTAGAAAAGCTTTGCCTTCACTGGGATTA
GCCAGTTACTTG


Conceptual translation

MQNISEVTEFILAG/IIFTLIYLTTLVGNLGMILLILLDSRLHTPMYFFLSNLSLVDRV
YASAVTPKVLEGFVTEDKIIFYDTCAAQMVFFAAFATIESFLLASMAYDI/AALCKPLH
YSTTMRTMNCARFLAGSYVSEL*QSSIHVAFTFHLSF*HSNVVNRFFCDI\PLLAV\C
SSIYTNEIILFMLTAFNVGFTLFIILTSYLLIFVAILRMNSAESQKKAISTCASHLTTVS
IFYLQPSSRHSMDTDKMASVFYTMVIPMLNPLVYSLRNKEVRNAFKKISRKALPSLGLAS
YL