Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5b94 Olfactory Receptor

Gene Symbol Or5b94
Organism Mouse
Family 5
Subfamily b
Pseudo No
Location chr19:12,674,200-12,675,100 (+)
Aliases Olfr1442

Sequence information


Nucleotide sequence

MENRTEMTGFILLGLTNAPELRAPLFIIISFIYFTNVIGNLGMIVLILWDSRLHTPMYCF
LANLSLVDIFYSSAVAPTILAGLLVGNIVVSYNACVAQMISFSAFVTTEDLLLAAMAYDR
YAAVCKPLHYTTIMTPTVCICLIMACYTGGFLNSSIHTGDTFRLSFCGSNAVHHFFCDVP
AVMTLSCSDRHVSEIVLIYGAGFIICSALLVILISYTFIFITIFRMRSAAGYQKAMSTCV
SHFTAVSIFYGTVIFMYLQPTSSHSMDTDKTVSVFYTMVIPMLNPMVYSLRNKEVKSAFK
KVVEKAKYSLGF


Conceptual translation

MENRTEMTGFILLGLTNAPELRAPLFIIISFIYFTNVIGNLGMIVLILWDSRLHTPMYCF
LANLSLVDIFYSSAVAPTILAGLLVGNIVVSYNACVAQMISFSAFVTTEDLLLAAMAYDR
YAAVCKPLHYTTIMTPTVCICLIMACYTGGFLNSSIHTGDTFRLSFCGSNAVHHFFCDVP
AVMTLSCSDRHVSEIVLIYGAGFIICSALLVILISYTFIFITIFRMRSAAGYQKAMSTCV
SHFTAVSIFYGTVIFMYLQPTSSHSMDTDKTVSVFYTMVIPMLNPMVYSLRNKEVKSAFK
KVVEKAKYSLGF