Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5b97 Olfactory Receptor

Gene Symbol Or5b97
Organism Rat
Family 5
Subfamily b
Pseudo No
Location chr1:229783168-229784288 (-)
Aliases Olr342-ps, Olr342-ps

Sequence information


Nucleotide sequence

AAGTAATATAGTTTATATTTTCAAGTTTAAGAAAATTTTCAAATTATATTCCTCTCTTTC
AGTTGCTATGGAGAATACAATGACTTGTAAAAGTACAATAATGAAGAATAGGACAGACGT
GACAGAGTTCATTCTGTTGGGACTCACCAATAAACCAGGCCTACAGCTTCCCCTGTTTAT
CATCATCCTTCTCATCTATACCATCACTCTGGTGGGAAACCTAGGGATGATCCTGCTAAT
TGTCCTGGACTCTCAGCTCCACACCCCCATGTACATTTTCCTTGGTAATCTTTCTCTGGT
GGATTTTTGTTACTCTTCAGTTGTCACCCCCACAGTCATGACTGAGCTTCTTGGAGGAGA
CAAGATCATTTCTCACAATAGCTGTGCTGCTCAGATGTTCTTTTTTGGAGCCTTTGGTAC
TGTGGAGAATTACCTGTTGGCTTCAATGGCCTATGATCGCTATGTAGCAGTGTGTAAGCC
CTTGCACTATGCCACCATCATGACTACAAGTGTGTATATGGGGCTCATCACTGGCTCTTA
TGTCATCAGTTTCATGAATGCCTCCATCCATGTTGCAGACATATTCACTCTTTCCTTCTG
CAAGTCCAATGTAATTCATCACTTTTTCTGTGATGTTCCAGCACTCATGATTCTCACTTG
TTTTGATAATCAAGTGAGGGAACTACTTCTTCTTTCCATTGAGAGTTTCAATATCTTGTT
TGCTTTCATAGTTATCTGTACTTCTTACATGCTAATTTTTGTCACCATCTCAAAGATGCA
CTCAGCTTCAGGACATCGCAAGGCTTTTTCCACCTGTGCCTCCCACTTCACTGCAGTATC
CATTTTCTATGGGACAGTCATTTTCATGTATTTACAGCCCAGCTCCAGTCATTCCATGGA
CACAGACAAAGTTACTTCTGTGTTCTACACCATGGTTATCCCTATGCTGAATCCTCTGAT
CTACAGCCTGAGGAACAAGGAGGTTAAGAATGCATTCTTAAAGTCAATACTACATTATTA
GTGGTAAAGAATGGATTCATTTGCTAAAGGCAAAAAATAGGATTTTAGTTTAACTTTGTA
GGATGCTATTTGTAGCTTCATTCTTCTCAGATTTCCTATAT


Conceptual translation

MENTMTCKSTIMKNRTDVTEFILLGLTNKPGLQLPLFIIILLIYTITLVGNLGMILLIVL
DSQLHTPMYIFLGNLSLVDFCYSSVVTPTVMTELLGGDKIISHNSCAAQMFFFGAFGTVE
NYLLASMAYDRYVAVCKPLHYATIMTTSVYMGLITGSYVISFMNASIHVADIFTLSFCKS
NVIHHFFCDVPALMILTCFDNQVRELLLLSIESFNILFAFIVICTSYMLIFVTISKMHSA
SGHRKAFSTCASHFTAVSIFYGTVIFMYLQPSSSHSMDTDKVTSVFYTMVIPMLNPLIYS
LRNKEVKNAFLKSILHY