Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5b99 Olfactory Receptor

Gene Symbol Or5b99
Organism Rat
Family 5
Subfamily b
Pseudo No
Location chr1:229849892-229850815 (+)
Aliases Olr346, Olr346

Sequence information


Nucleotide sequence

ATGGAGAATTGTACCAAAGTGAGAGAGTTCATTCTCCTGGGACTAACTGATGACCCAGGC
TTGCAGGTTCCCCTTTTCATCATGTTCACCATCATTTACCTCATTGATGTGGTTGGAAAC
ATGGGGATGATAATGTTGGTTCTCATGGACTCTCATTTGCACACGCCCATGTACTTTTTC
CTTTGTAACCTGTCTCTTATAGACTTGGGTTACTCCTCAGCTGTCACTCCCATGGTGATG
TCTGAATTGCTCATGGTCTCCAAGGTGGTGTCATACAATGCCTGTGCTGCACAGATGTTC
TTCTTTGTAGGCTTCGCCACTGGGGAAAATTACCTCTTAGCATCAATGGCCTATGACCGC
TATGTAGCAGTATGCAAACCCCTGCATTATTCCACCAGGATGACAACAAGTGTTTGTATT
TGTTTGAACATTGGCTCTTATATCTGTGGTTTCTTGAATGCCATTTTTCATGTTGGAGAC
ATATTCAGCCTTTCTTTTTGTAAATTTAATATAGTCCATCATTTTTTCTGTGATGTTCCA
GCAGTTCTGGCTCTATCTTGCTCTGATATACACCTCAGTGAAATGATTCTTGTTTTTTTG
TCAACATTCAATGTCTTCTTTGCTCTTCTGATCATCTTAGTTTCCTATCTCTTTATATTT
ATTACCATCTTGAAGATGAAATCAGACAAGGGACACCAAAAAGCTTTGTCCACCTGTACC
TCCCACCTCACTGTAGTTTCCATATTTTATAGCACTGTCATTTTCATGTACTTACAACCC
AGTTCCAGTCATTCCATGGATGCAGATAAAGTAGCATCTATGTTCTACACTATGATCATC
CCCGCACTAAACCCTTTGGTCTATAGCCTGAGGAATAAGGAAGTGAACAATGCATTCAAG
AAAATGGTTAAGAAATCAACTTTA


Conceptual translation

MENCTKVREFILLGLTDDPGLQVPLFIMFTIIYLIDVVGNMGMIMLVLMDSHLHTPMYFF
LCNLSLIDLGYSSAVTPMVMSELLMVSKVVSYNACAAQMFFFVGFATGENYLLASMAYDR
YVAVCKPLHYSTRMTTSVCICLNIGSYICGFLNAIFHVGDIFSLSFCKFNIVHHFFCDVP
AVLALSCSDIHLSEMILVFLSTFNVFFALLIILVSYLFIFITILKMKSDKGHQKALSTCT
SHLTVVSIFYSTVIFMYLQPSSSHSMDADKVASMFYTMIIPALNPLVYSLRNKEVNNAFK
KMVKKSTL