Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5bb12 Olfactory Receptor

Gene Symbol Or5bb12
Organism Mouse
Family 5
Subfamily bb
Pseudo No
Location chr19:12166189-12167055 (-)
Aliases Olfr1555

Sequence information


Nucleotide sequence

ATGTTTGTCCTCCTGGGGCTCTTGGACCAAGCTGAGCTGCAGCTCATCCTTTTTCCTGTC
TTTCTAGGGACATACCTCATTACTCTGATTTGGAACCTGGGCCTTATCATCCTCATCAGA
ATGGACTCTCACCTACAAACACCCATGTACTTTTTTCTCAGTTTCCTGTCATTTATAGAT
ATATGCTATTCTTCTTCTATCAGCCCAAGGATGCTTTCAGACTTCTTAAAAACAGAGAAA
ACAATTTCCTTCATTGCTTGTGCCACTCAGAATTTTGTTTTGGATTGGATGGGTACATCT
GAGTGCTGCTTGCTGGCTGCCATGGCCTATGACAGGTATGTGGCCATTGGTAGCCCTCTG
CAGTACTCAGCCATCATGGCTCCCAGTCTTTGCTGGAGGATGGTTGCTGGTGTCTATGGG
AGTGGATTCTTTATTAGCTTTGTTCATACAGTTGCTTGTTTTAATCTCTACTATTGTGGG
CCAAATGTCATTCGTCATTTCTTCTGTGACATTCCTCAGATCATTCCCTTGTCTTGCTCT
GATCCCTTCATCAGCCAGCTGGTTCTTTTCCTGGCAGCTCTTTTTGTTGGGTTTGGCTCT
TTCCTTGTTATTCTCTTATCCTATGTATTCATTGCAGTTTCCATCCTGAAAGTGGCCTCA
TTCAAAGGCCGTGTCAAAGCATTCAAGACATGTGGCTCCCACCTGGCAGCAGTGACTCTC
TTCTATGGCACAGTCTTCTCTGTGTACATGCACCACAGCTCTCAGCACTCCACAAAGCAA
GACAAGGTGCTGTCTGTGGTCTACACCATCCTCATCCCCATGGTAAACCCTCTGATCTAC
AGTCTGAGGAACACAGAGATTAAGGAG


Conceptual translation

MFVLLGLLDQAELQLILFPVFLGTYLITLIWNLGLIILIRMDSHLQTPMYFFLSFLSFID
ICYSSSISPRMLSDFLKTEKTISFIACATQNFVLDWMGTSECCLLAAMAYDRYVAIGSPL
QYSAIMAPSLCWRMVAGVYGSGFFISFVHTVACFNLYYCGPNVIRHFFCDIPQIIPLSCS
DPFISQLVLFLAALFVGFGSFLVILLSYVFIAVSILKVASFKGRVKAFKTCGSHLAAVTL
FYGTVFSVYMHHSSQHSTKQDKVLSVVYTILIPMVNPLIYSLRNTEIKE