Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5bb12 Olfactory Receptor

Gene Symbol Or5bb12
Organism Rat
Family 5
Subfamily bb
Pseudo No
Location chrUn_KL568473v1:24000-24965 (-)
Aliases Olr327, Olr327

Sequence information


Nucleotide sequence

ATGATGACAAGCAGATCTGTGTTGGGAGATAGAAACCACACCTCAGTGACCATGTTTTTC
CTCCTGGGGCTCTTGGAACAAACTGAACTACAGCTTATCCTTTTTCCTGTCTTCCTAGGA
ACCTACATCATTACTCTGATTTGGAACCTGGGCGTGATCATCCTCATCATAATGGACTCT
CACCTGCAAACACCCATGTACTTTTTTCTCAATTTCCTGTCATTTATAGATATATGCTAT
TCTTCTTCTATCAGCCCAAGGATGCTTTCAGACTTCTTAAGAGCAGAAAAGACAATTTCC
TTCACTGACTGTGCCACTCAGTATTTTGTTTTGGCCTGGATGGGTATGTCCGAGTGCTAC
CTGCTAGCTGCCATGGCCTATGACAGGTATGTGGCCATCGGTAGCCCTCTGCAGTACTCA
ACCATCATGGCTCCCAGTCTTTGCTGGAAAATGGTTGCTGGTGTCTATGGGAGTGGTTTC
TTTAGTAGCTTTGCTCAAACAGTTGCTTGTTTTAATCTCTACTATTGTGGGCCAAATGTC
ATCCATCATTTCTTCTGTGACGTGCCTCAGATCATTTCCTTGTCTTGTTCTGATCCCTTC
ATCTGCCAGCTGGTTCTTTTCCTGGCGGCTGTTTTTATTGGGTTTGGCTATTTCCTTGTT
ATCCTCTTATCCTATGTATTCATTGCAGTTTCCATCCTGAAAGTGGCCTCATTCAAGGGC
TGTGTCAAGGCCTTCAAGACATGTGGCTCCCACCTGGCAACAGTGACTCTCTTCTATGGC
ACAATCCTCTCTGTGTACATGCACCACAGCTCTCAGCATTCCACAAAGCAAGACAAGGTG
CTGTCTGTGGTCTATACTATCCTCATCCCCATGATAAACCCTCTGATCTACAGTCTGAGG
AACACAGAGATCAAGGGGGCCCTCAAGAGAATGATGAAGAAGGCACCACATTTACTTCAG
AAAGCA


Conceptual translation

MMTSRSVLGDRNHTSVTMFFLLGLLEQTELQLILFPVFLGTYIITLIWNLGVIILIIMDS
HLQTPMYFFLNFLSFIDICYSSSISPRMLSDFLRAEKTISFTDCATQYFVLAWMGMSECY
LLAAMAYDRYVAIGSPLQYSTIMAPSLCWKMVAGVYGSGFFSSFAQTVACFNLYYCGPNV
IHHFFCDVPQIISLSCSDPFICQLVLFLAAVFIGFGYFLVILLSYVFIAVSILKVASFKG
CVKAFKTCGSHLATVTLFYGTILSVYMHHSSQHSTKQDKVLSVVYTILIPMINPLIYSLR
NTEIKGALKRMMKKAPHLLQKA