Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5bc4-ps Olfactory Receptor

Gene Symbol Or5bc4-ps
Organism Mouse
Family 5
Subfamily bc
Pseudo Yes
Location chr19:13462690-13463635 (-)
Aliases Olfr1473-ps1, MOR202-25P

Sequence information


Nucleotide sequence

ATTAATTTGGTGGAGAATATTTCAGAGGTTACTGAATTTATTCTCGTGGGGATAACAGAT
GCCCCAGAGCTTCTGATCCCTTTATTTATTATCTTCACTCTCATTTATTTGATCGCACTG
TTTGGAAATCTTGGGATGATCATGTTGATTCTGCTAGACTCCCGACTCCACTCTCCCATG
TACTTTTTCCTCTGTAACCTCCCCCTGGTGGACTGTGTTTATGCCTCAGCAATCACCCCC
AAGGTGATGGAAGGGTTTCTCACAGGAAATAAGATAATATCCTACAATGCATGTGGTGCC
CAGATGTTCTTCTTTGTAGCCTTTGGTGCTATTGAAAGTTTGATCCTTGCCTCAATGGCC
TATGACTGTCAAGCAGGTGCGTGAAAACTCCTCCACTATACTACCATTATGACAAGTAGT
ACCTGTATTCTCATTGTCACTTGCTGCTACATGTGTGGGATCTTACAATCTTCTGTTCAT
GTTGCTCTTGCATTTTGTCTATTCTTCTGTCACTCCAACATGATTAATCACTTTTCCTGT
GACATTCCCCCACTGCTGGAAATTTCTCGTTCTGACACCCACACAAATGGGATTACACCC
CTTATCTTGGCTACATTAGATCTTGTTTTCACTCTCTTGGTTATCTTAAACACTTACCTG
CTTATTTTCATTGCTATCCTGAGGATGCATTCAGCTGAAGCACAGAGGAAGGACTTTTCT
ACCCGTGTATCTCATCTCATCACTGCGTCCATCTTCTTTGGTTCCCTTATATTCATGTAC
TTACAACCTAGTTCTAGTCACTCCCCAGAGGCAGACAAAATTGCATCTGTGTTTTATACC
ATGGTTATCCCTATCTATGTTCAACCCTGTGGCCTACAGCCTGAGGAATATAGAGGACAA
GTGTGCATTTAAGAAGGTTGTTGGTAAGCTAAGAACTTCACTTCAT


Conceptual translation

INLVENISEVTEFILVGITDAPELLIPLFIIFTLIYLIALFGNLGMIMLILLDSRLHSPM
YFFLCNLPLVDCVYASAITPKVMEGFLTGNKIISYNACGAQMFFFVAFGAIESLILASMA
YDCQAGA*KLLHYTTIMTSSTCILIVTCCYMCGILQSSVHVALAFCLFFCHSNMINHFSC
DIPPLLEISRSDTHTNGITPLILATLDLVFTLLVILNTYLLIFIAILRMHSAEAQRKDFS
TRVSHLITASIFFGSLIFMYLQPSSSHSPEADKIASVFYTMVIPI\FNPVAYSLRNIED
KCAFKKVVGKLRTSLH