Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5be3 Olfactory Receptor

Gene Symbol Or5be3
Organism Rat
Family 5
Subfamily be
Pseudo No
Location chr3:74,606,100-74,607,100 (-)
Aliases Olr537

Sequence information


Nucleotide sequence

ATGGCTGACAGAAATTTGACTGTGATAACTGAGTTTATCCTACTGGGCCTGACTGAGGAC
CCTCTACTGAATACTGTACTCTCTGTGCTGTTTCTCTTAATTTATGTCATTACTGTAGCA
GGCAATTTCTGGATTATTGTGATAATTTTAGCTACTGCCCAGCTTCATTCCCCCAAATAC
TTTTTCCTTAGTCACTTGGCTTTCTTGGATTTCTCCTACTCATCAGTCTTTCTTCCCAAA
ATGCTGATAAACTACTTGGTAGGGCAAAACAGCATCTCGTACCAAGGCTGTCTTCTACAG
TATTCCTGTGTCAACATGTTCCTGACTGCAGAATGCTTCCTCTTAGCTGCAATGGCCTAT
GATAGGTATCTTGCCATCTGCAGTCCACTTCACTACAGAGGTCTTATGACTCCCACGTTT
TGCATCTACCTTGTATCAGCCTCTTATCTGCTAGGGTGTGCCAACTCCCTTACCCACTTG
AGGAGCCTTCTCAATTTGACTTTTTGTGGGCCCAATGTCATTGACCATTATTTCTGTGAC
ATTCCATTGCTCTTTCAGCTCTCCTGCTCTGATACCTATGCCAGTGAGGTTTTATTCGTT
GTTCTTTCTGGTGCTACATCCATAACTACTTTTCTGATAGTAGTTAGTTCCTATTTGGGA
ATTCTTATCACTGTCCTAAAAACAAATTCTGCCAGGGGAAGTTATAAGGCCTTATCCACA
TGTGCCTCCCACCTAACTGTAGTAACTCTCTTCTATGGAACAGTGATATCTACTTACCTG
GGAACCAGCTCAAGCTTCCCACAAGATACAGAAAAAATCTTATCTGTGTTTTACACACTT
TTGCTGCCAGTACTGAATCTTTTAATATACAGTGTGAGAAACAAAGAGGCCAAAGAAGCC
ATGAGAAGGATGATTAAGAGAAAAATACTGTCTCAG


Conceptual translation

MADRNLTVITEFILLGLTEDPLLNTVLSVLFLLIYVITVAGNFWIIVIILATAQLHSPKY
FFLSHLAFLDFSYSSVFLPKMLINYLVGQNSISYQGCLLQYSCVNMFLTAECFLLAAMAY
DRYLAICSPLHYRGLMTPTFCIYLVSASYLLGCANSLTHLRSLLNLTFCGPNVIDHYFCD
IPLLFQLSCSDTYASEVLFVVLSGATSITTFLIVVSSYLGILITVLKTNSARGSYKALST
CASHLTVVTLFYGTVISTYLGTSSSFPQDTEKILSVFYTLLLPVLNLLIYSVRNKEAKEA
MRRMIKRKILSQ