Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5bi1-ps Olfactory Receptor

Gene Symbol Or5bi1-ps
Organism Rat
Family 5
Subfamily bi
Pseudo Yes
Location chr3:73077398-73078030 (-)
Aliases Olr452-ps, Olr452-ps

Sequence information


Nucleotide sequence

TAACAAACCTATTCAGAATACTCTGCCATTGGTATCAAATATCACTTGACCGATGATTAT
AAGTCATAATTATTATTCTTTTACATATCCTAACTGAGCAATGGAAGAAAAAAGTCAGAC
TACAGTGACCAATTCTCTCTCTCTGTGCCTCGCAAAGCACCTCCATCAGAAGACTGTCTT
CTTCATCATGTTTTCCTTTGTTTATCTTATCATTCTTGAGGGCAATGTGGGCCTGACCAC
TCACATATGGGTAAATGCCAGGCTGTACATTCATATGTACTTTTTCCCCAGCTGTCTTTG
TAGAGGTCTAGATATCTTCTTCCATAGCTCCCAAGACAATGTGTAACGTTTTTCATTCGG
AGAACAAAGCCATCTCACTCATGGGCTATGGATCACAGATGTGGTTCTTTAGTCTCATCA
CAAGAACCTAGTGTTCTTCCTGGCTGCCATGGTATATGGTTGTAAATGCATCTCTTTTTT
TGGTGTAAAAGTCACCTTCAAGGCTTGTTGATGAAATAGTCCACCCTTTCTAATTTTCTC
ACATATCACTTGCTGATCAGCATTCATTAGTCCAATACCTACCTTTTACCAACTTCTATA
AATCCCATAAGGGTAAGTTTTTCTAGCTAAATT


Conceptual translation

MEEKSQTTVTNSLSLCLAKHLHQKTVFFIMFSFVYLIILEGNVGLTTHIWVNARLYIHMY
FFPSCL\EV*ISSSIAPKTMCNVFHSENKAISLMGYGSQMWFFSLITRT*