Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5bo1-ps Olfactory Receptor

Gene Symbol Or5bo1-ps
Organism Rat
Family 5
Subfamily bo
Pseudo Yes
Location chr3:76,340,800-76,341,800 (-)
Aliases Olr612-ps

Sequence information


Conceptual translation

VENCSATEFCFLGIRNNYG*SVYIFPHFHLIISIDNFGLINLNRMDNQIHTLMYFFLSYL
YSSDVCYFIV/KKLVVHQLVTNMNSNSITFLDYDVHVFNFLNITGIQCILLEIMAFD*/br/>YDDSQKPLLYAVDMSSNVCY/LLPVVYLVGIVDAVIYTILAF/ICFC*SNEIFF/FY
LHI/LLSCSDIQFKEWLSSLFFGSTEMSTFSGILPSFCFISFHCRRESQGFSNSTYYLR
VVASGSTISNFLRKLQTHFQS