Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5d16-ps Olfactory Receptor

Gene Symbol Or5d16-ps
Organism Rat
Family 5
Subfamily d
Pseudo Yes
Location chr3:76,079,500-76,080,400 (-)
Aliases Olr600-ps

Sequence information


Nucleotide sequence

ATGTTTCTGACAGACATAAATCTAACTTCTGAGGTCACATTCACTCTCTTGGGCTTCTCA
GATTACCCAGAACTGCAGGTTCCTCTCTTCTTGTTGTTTCTGGCAATCTACAGCTTCAGT
GTGCTAGGGAATCTAGGGATGATAATGATCATTAAGATTAACCCCAAACTGCACACCCCC
ATGTACTTCTTCCTCAGCCACCTTTCCTTTGCAGATTTCTGCTATTCCTCGATCATTGCT
CCCAAGATGCTGGTGAACCTTGTCATAGAAGACAGGACCATTTCCTTTTCAGGATGCATA
ATGCAGTTCTTTCTCTTTTGCACATTTGTAGTGACTGAACTAATTCTATTTGCTGTGATG
GCCTATGACTGCTTTGTGGCTGTCTGTAACCCCCTGCTGTACACAGTTGTCATGTCACAG
AGACTCTGAGCACTGCTAGTGCTAGGATCATATGCATGGGGAGTGGTGTGCTCATTGACA
CTAACCTGCTCTGCTTTGAATTTATATTTCCGAGGTTTCAACACAATTAATCACTTCTTC
TGTGAACTCTCCTCCCTGATAGCCCTTTCTTGCTCTGATTCTAAACTCAGCCAGTTACTG
CTTTTTATTGTTGCTACTTTCAATGAGATAAGCACACTGCTCATCATTCTTACATCATAT
TTGTTCATTATTGTCACTGCCCTGAAAATGAATTCATCTAGTGGGCACCGCAAAGTCTTC
TCTACCTGTGCTTCCCACATGACGGCCATCACCATCTTCCATGGAACCATATTATTCCTC
TACTGTGTGCCCAACTCCAAGAACTCCAGGCACACTGTCAAAGTGGCTTCTTTGTTTTAC
ACAGTGGTGATCCCCATGCTAAACCCCTTAATCTACAGTCTGAGAAATAAAGATGTCAAA
GACACAGTCAGTAAAATAATGAAAGTAAGATATTTTTCTCAGCCT


Conceptual translation

MFLTDINLTSEVTFTLLGFSDYPELQVPLFLLFLAIYSFSVLGNLGMIMIIKINPKLHTP
MYFFLSHLSFADFCYSSIIAPKMLVNLVIEDRTISFSGCIMQFFLFCTFVVTELILFAVM
AYDCFVAVCNPLLYTVVMSQRL*ALLVLGSYAWGVVCSLTLTCSALNLYFRGFNTINHFF
CELSSLIALSCSDSKLSQLLLFIVATFNEISTLLIILTSYLFIIVTALKMNSSSGHRKVF
STCASHMTAITIFHGTILFLYCVPNSKNSRHTVKVASLFYTVVIPMLNPLIYSLRNKDVK
DTVSKIMKVRYFSQP