Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5d18 Olfactory Receptor

Gene Symbol Or5d18
Organism Mouse
Family 5
Subfamily d
Pseudo No
Location chr2:88034199-88035137 (-)
Aliases Olfr73, RP23-131J21.3, MOR174-9, fascin-1, mOR-EG, RP23-131J21.3, MOR174-9, fascin-1, mOR-EG

Sequence information


Nucleotide sequence

ATGACTCTGTCAGATGGAAATCACAGTGGGGCTGTGTTCACCCTCTTGGGCTTCTCAGAT
TATCCAGAATTGACAATCCCTCTCTTTTTGATATTTCTCACCATCTACAGCATCACTGTG
GTAGGAAATATTGGCATGATTGTCATAATCAGAATTAATCCCAAACTGCACATCCCCATG
TACTTCTTTCTCAGCCACCTCTCTTTTGTGGATTTTTGTTATTCCTCCATTGTTGCTCCC
AAGATGCTGGTAAATCTAGTTACAATGAACAGAGGCATATCATTTGTAGGATGCTTAGTG
CAATTCTTTTTTTTCTGTACTTTCGTGGTAACTGAATCTTTTCTATTAGGAGTGATGGCT
TATGACAGGTTTGTGGCCATCCGCAACCCTCTACTCTACACAGTGGCCATGTCCCAGAGG
CTCTGTGCCATGCTGGTATTGGGATCCTATGCTTGGGGGGTGGTATGCTCCTTGATACTG
ACCTGCTCTGCCTTGAATCTTTCTTTTTATGGTTTCAATATGATCAACCACTTTTTTTGT
GAGTTCTCCTCTCTCCTTTCACTTTCACGCTCTGACACATCTGTCAGTCAACTGTTGCTT
TTCGTTTTTGCCACTTTTAATGAGATTAGCACACTCCTTATCATTCTCTTGTCTTATGTG
CTCATTGTTGTTACTATTCTGAAGATGAAGTCAGCAAGTGGACGCCGCAAAGCCTTCTCC
ACTTGTGCTTCCCATCTGACAGCTATAACCATCTTCCATGGAACAATCCTATTCCTATAC
TGTGTACCTAACTCCAAGAACTCCAGGCATACCGTAAAAGTGGCCTCTGTGTTTTACACA
GTGGTGATCCCCATGCTGAATCCCCTAATATACAGTCTGAGAAATAAGGATGTCAAGGAC
ACAGTAAAAAAAATAATAGGTACTAAAGTCTATTCTTCT


Conceptual translation

MTLSDGNHSGAVFTLLGFSDYPELTIPLFLIFLTIYSITVVGNIGMIVIIRINPKLHIPM
YFFLSHLSFVDFCYSSIVAPKMLVNLVTMNRGISFVGCLVQFFFFCTFVVTESFLLGVMA
YDRFVAIRNPLLYTVAMSQRLCAMLVLGSYAWGVVCSLILTCSALNLSFYGFNMINHFFC
EFSSLLSLSRSDTSVSQLLLFVFATFNEISTLLIILLSYVLIVVTILKMKSASGRRKAFS
TCASHLTAITIFHGTILFLYCVPNSKNSRHTVKVASVFYTVVIPMLNPLIYSLRNKDVKD
TVKKIIGTKVYSS