Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5d35 Olfactory Receptor

Gene Symbol Or5d35
Organism Mouse
Family 5
Subfamily d
Pseudo No
Location chr2:88,024,700-88,025,700 (+)
Aliases Olfr1161

Sequence information


Nucleotide sequence

MLLTYGNNSGAMFILLSFSDYPEIEMPLFLVFLAIYSITVVGNIGMIVIIRINPKLHTPM
YFFLSHLSFVDFCYSSVIAPKMLVNLFIKDRAISFLECIVQYFFFAIFVVTETILLVVMA
YDRFVAICRPLLYTVAMSQKLCISLVVGSYAWGLICSLTMTCSIIQLSFVGINTIDHFFC
EFSSLLVLSCSDTHVNQILLFSLSTVNALSTLLIILLSYMFILVTILKMQSSRGRQKAFY
TCASHLTTITIFYGTILFLYSVPNSKNSQLTFKVASLFYTLVIPMLNPLIYSLRNKDVKD
TIRQIMKIKFIALPHLSSKVR


Conceptual translation

MLLTYGNNSGAMFILLSFSDYPEIEMPLFLVFLAIYSITVVGNIGMIVIIRINPKLHTPM
YFFLSHLSFVDFCYSSVIAPKMLVNLFIKDRAISFLECIVQYFFFAIFVVTETILLVVMA
YDRFVAICRPLLYTVAMSQKLCISLVVGSYAWGLICSLTMTCSIIQLSFVGINTIDHFFC
EFSSLLVLSCSDTHVNQILLFSLSTVNALSTLLIILLSYMFILVTILKMQSSRGRQKAFY
TCASHLTTITIFYGTILFLYSVPNSKNSQLTFKVASLFYTLVIPMLNPLIYSLRNKDVKD
TIRQIMKIKFIALPHLSSKVR