Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5d36 Olfactory Receptor

Gene Symbol Or5d36
Organism Mouse
Family 5
Subfamily d
Pseudo No
Location chr2:88,070,400-88,071,400 (-)
Aliases Olfr1163

Sequence information


Nucleotide sequence

MVPLEINVSVEINFVLLGFTDYPNLQIPLFLIFLFMYIITVVGNLGMTVLINIDHKFHTP
MYFFLSHLSFVDFCYSTIITPKLLENLVLADKTILYFSCMLQYFLSCVALVSESYLLAVM
AYDRFVAICNPLLYTVAMSPRLCILLVTGSYIWSTFETLILLCYALQLKFSRFNVINHFF
CEYTALIVVSSSDIHIPSLLLFCFATFNEVSTLLIILTSYVLIFVTVLKIKSASGRRKAF
STCASHLTAITIFHGTILSLYCVPNSKNSRNAVKVASVFYAVVNPLLNPLIYSLRNKDVK
EVFQKLVSTSLKFQLH


Conceptual translation

MVPLEINVSVEINFVLLGFTDYPNLQIPLFLIFLFMYIITVVGNLGMTVLINIDHKFHTP
MYFFLSHLSFVDFCYSTIITPKLLENLVLADKTILYFSCMLQYFLSCVALVSESYLLAVM
AYDRFVAICNPLLYTVAMSPRLCILLVTGSYIWSTFETLILLCYALQLKFSRFNVINHFF
CEYTALIVVSSSDIHIPSLLLFCFATFNEVSTLLIILTSYVLIFVTVLKIKSASGRRKAF
STCASHLTAITIFHGTILSLYCVPNSKNSRNAVKVASVFYAVVNPLLNPLIYSLRNKDVK
EVFQKLVSTSLKFQLH