Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5d37 Olfactory Receptor

Gene Symbol Or5d37
Organism Rat
Family 5
Subfamily d
Pseudo No
Location chr3:76278127-76279104 (-)
Aliases Olr608, Olr608

Sequence information


Nucleotide sequence

ATGAATTCTGTGGTTCCTTCTACCAGAAGCCAATGGTGGAATGAGGGAAATCAAAGCATG
GTGTCTTCTTTTATTTTGTTGGCTTTTTCAGAATTTCCAAACCTCCAATTGCCCCTGTTC
CTGGTATTCTTGATCATGTACACAGTTACTGTGTTGGAAAATCTTGGTATGATTTTTGTC
ATCAGAATAAATCCCAAACTCCACACTCCTATGTACTTTTTTCTCAGCCACTTATCCTTT
GTTGATTTTTGCTACACATCTGTAATTGCACCAAAGCTGTTAGACCTCTTGCTTGTGGAA
GACAAATCAATCTCCTTTGAAGGGTGCATGGTGCAATACTTTCTTGGGTGTACATTTGTG
ATTACAGAGATGTTCATGTTGGCAGTGATGGCCTATGACAGGCTAGTGGCTGTTTGTAAT
CCTCTGCTTTACACTGCTGCCATGTCTCAGGAGCTCTGCTCAATCCTGGTAGTAGTTACT
TACATATGGGCTGGAATATTTTCCTCAACTCTCACATACATTCTTTTGCAGCTCTCTTAC
TGTGGACCTAATGTCATCAATCACTTTTGCTGTGAGTACTCTGCCCTCCTTTCTGTATCC
TGCTCAGATATCTCCTTCAGCCAAACAGCATGTCTAGTCATTTCTATGTTTAATGAGGCT
TGTTGCCTCCTGATCATCATCACCTCCTATGTTTTCATAGGTGTCACTATCATCAAAATT
CCCACAAAGGGGGCCTTCCAAAAAGCATTATCCACCTGTGCCTCACATCTTACAGCTATT
GGTGTCTGTCATGGGATCGTTCTTCTACTGTATTGTGTGCTCAAATCCAAAAGCTCATTG
TTTCTTGTAAAAGTCGCCACTGTATTCCACAGCATGGTCATCCCTATGCTGAATCCCCTC
ATCTACAGCCTCAGAAATACAGATGTTAAAGAGACTGTCAGAAAGTTAGTCTACCTGAAA
TGTATTTTTCATTCAATA


Conceptual translation

MNSVVPSTRSQWWNEGNQSMVSSFILLAFSEFPNLQLPLFLVFLIMYTVTVLENLGMIFV
IRINPKLHTPMYFFLSHLSFVDFCYTSVIAPKLLDLLLVEDKSISFEGCMVQYFLGCTFV
ITEMFMLAVMAYDRLVAVCNPLLYTAAMSQELCSILVVVTYIWAGIFSSTLTYILLQLSY
CGPNVINHFCCEYSALLSVSCSDISFSQTACLVISMFNEACCLLIIITSYVFIGVTIIKI
PTKGAFQKALSTCASHLTAIGVCHGIVLLLYCVLKSKSSLFLVKVATVFHSMVIPMLNPL
IYSLRNTDVKETVRKLVYLKCIFHSI