Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5d38 Olfactory Receptor

Gene Symbol Or5d38
Organism Mouse
Family 5
Subfamily d
Pseudo No
Location chr2:88124036-88124983 (-)
Aliases Olfr1166, RP23-131J21.9, MOR174-6, RP23-131J21.9, MOR174-6

Sequence information


Nucleotide sequence

ATGGCTTATGAAGTGATGAACCAGACTTCTGCGACCACATTCATCTTGGTTGGTTTCTCA
GAATATCCACAGCTCCAAAAACCCCTCTTCCTCCTGTTCTTGGCCATCTACTCAGTAACA
TTGGTGGGGAACCTGGGCATACTTGTGGTTATAAAGGTCAATCCCAAACTTCACACACCC
ATGTACTTTTTTCTTAGCCACCTATCATTTTTAGATATATGCTATTCTAGTGTATTTACA
CCCAAACTTTTGCAGATCTTGATCATGGAAGATAGGACTGTATCTTTCAAAGCATGCATG
GTACAATTTTTCTTTATTTGTACATTCGTGATTACAGAAATGTTCATGTTAGCAGTGATG
GCCTATGACAGGTTTGTGGCTGTTTGTAATCCCCTACTCTACACAGTTGTGATGCCTTTT
CAATTCTGTGCTCTGCTAGTAGCTGGGACATATATGATTGGTGGACTATGTACTGTGATA
CTTCTATATACCCTTTTGCAACTCTCCTATTGTGAATATGGCATCATCAATCACTTTGGC
TGTGAGTACTCCGCTGTCATCTCTGTGTCTTGCTCTGACTCCTCCTTTAGCCAGTTGACA
TCCTTAGTCATTGCTATAGTTAGTGAATCTTCTAGTGTCCTGATCACTCTAGCATCATAT
GTGTTCATAGTTGTCACTATTATAAAGATGCCTTCCAAAGGAGGACTGAGAAAAGCCTTC
TCCACCTGTACTTCCCACCTGACTGCCATATCAATCTTCCATGGGATCATACTCCTCCTG
TACTGTGTTCCCAACTCAAACAGCTCACGGCTCTTTGTCAAAGTGGCCACTGCTCTTTAT
ACAATCATGATCCCTATGTTGAACCCCCTTATCTATAGCCTTAGAAATAAAGATGTGAAG
GACACAGTCAGGAGACTTATCAGCTCAAAACTGCACTCTCACTTGACA


Conceptual translation

MAYEVMNQTSATTFILVGFSEYPQLQKPLFLLFLAIYSVTLVGNLGILVVIKVNPKLHTP
MYFFLSHLSFLDICYSSVFTPKLLQILIMEDRTVSFKACMVQFFFICTFVITEMFMLAVM
AYDRFVAVCNPLLYTVVMPFQFCALLVAGTYMIGGLCTVILLYTLLQLSYCEYGIINHFG
CEYSAVISVSCSDSSFSQLTSLVIAIVSESSSVLITLASYVFIVVTIIKMPSKGGLRKAF
STCTSHLTAISIFHGIILLLYCVPNSNSSRLFVKVATALYTIMIPMLNPLIYSLRNKDVK
DTVRRLISSKLHSHLT