Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5d40 Olfactory Receptor

Gene Symbol Or5d40
Organism Rat
Family 5
Subfamily d
Pseudo No
Location chr3:76367962-76368909 (-)
Aliases Olr614, Olr614

Sequence information


Nucleotide sequence

ATGATACATGCAATGATAAACCAGAGTTCTGTAACCACATTTATTCTGGTGGGCTTCTCA
GAATACCCACACCTCCAGCTACCCCTCTTCCTTATGATACTGACCATTTACACAATCACT
CTGGTAGGAAATGTTGGCATAATTGTGATCCGAAGGATCAACCCTAAGCTTCACACACCC
ATGTACTTTTTCCTGAGTCATCTTTCATTTTTGGATATATGTTATTCTAGTGTATTTACA
CCAAAATTGTTAGAGATCTTGATTGTGGAAAACAGAACTATTTTCTTAAAAGATTGCATG
ACACAGTTTTTCTTTGGCTGTGCATGCGTGATTACAGAGATGTTCATGTTAGCAGTGATG
GCCTACGACAGGTTTGTGGCTGTTTGCAACCCTCTGCTCTATACTGTTGCTATGTCTCAT
CAATTGTGTGGTCTCCTAATAGCTGGAAGTTATATGTGGGGAGGTCTGTGTGCTGTGATA
ATCACGTACACTCTCTTAGAGCTGTCTTATTGTGAACCTGGAATCATCAATCACTTTGGC
TGTGAGTATTCAGCCATCATCTCTGTATCCTGTTCTGACCCCTCCTTCAGCCAGATGACA
TGCTTAGTCATTTCCATATTAAGTGAGGGTAGTAGCCTTCTTATCACTATGGCCTCCTAT
GTCTTCATAGTTGTTACAATCATCAAAATGCCTTCTAAAGGTGGACTCCGAAAAGCCTTC
TCCACCTGCACTTCCCACCTGACTGCTATCAGCATCTTCCATGGGATTATTCTCCTTCTG
TACTGTGTACCCAACGCAAAGAGCTCACAGCTCCTAGTCAAAATAGCAACTGTGCTCTAT
ACAGTCCTGATTCCCATGCTGAACCCCCTCATCTACAGCCTACGGAACAAAGATGTAAAG
GACACAGTGAAGAGGCTCATCGGCTCAAAACTGCACCGTCATTCAATG


Conceptual translation

MIHAMINQSSVTTFILVGFSEYPHLQLPLFLMILTIYTITLVGNVGIIVIRRINPKLHTP
MYFFLSHLSFLDICYSSVFTPKLLEILIVENRTIFLKDCMTQFFFGCACVITEMFMLAVM
AYDRFVAVCNPLLYTVAMSHQLCGLLIAGSYMWGGLCAVIITYTLLELSYCEPGIINHFG
CEYSAIISVSCSDPSFSQMTCLVISILSEGSSLLITMASYVFIVVTIIKMPSKGGLRKAF
STCTSHLTAISIFHGIILLLYCVPNAKSSQLLVKIATVLYTVLIPMLNPLIYSLRNKDVK
DTVKRLIGSKLHRHSM