Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5d45-ps Olfactory Receptor

Gene Symbol Or5d45-ps
Organism Rat
Family 5
Subfamily d
Pseudo Yes
Location chr3:76399386-76399982 (-)
Aliases Olr616-ps, Olr616-ps

Sequence information


Nucleotide sequence

AGTATCTATGAAAACGAGACTTCTGCTGTGACCTTCATCCTCGTGGGTTTCTCAGAATAC
CCACACCTCCAAGTGCCCCTGTTCCTCCTGTTCCTTACCATATACACAGTCACTGTGCTG
GGGAACCTGGGCATGATTGCTCTCATCAGGATCAGCCATAAGCTCCACACTCCCATGTAC
TTTTTTCTAAGTCATCTTTCCTTTGTGGATTTCTGTTACTCCACTGTTGTCACACCAAAG
CTCTTAGAAAACTTGATTGTGGAAGACAGAAGGATCTCCTTCACCGGTTGTGTCATGCAA
TTCTTCTTTGCATGCATATTTGTGGTGACAGAAACCTTTATGTTGGCAGTGATGGCCTAT
GACAGGTTTGTGGCAGTATGTAATCCTCTTCTCTACACAGTGGCTATGTCTCAGAAGCCC
TGCTGGTCCCTGGTAGCTACATCATGCTCCTGGAGTATAATCTGTTCCTTTATATTCATC
CATTTTATGTTGACCTTGGTTTTCTGTGGTACCAAGTTCATAAATAACTTTGTGTGTGAA
CACGATGCCATTGTTGCTGTTTCCTGCTCCGACCCCTACATTAGTCAGAAGGTCATT


Conceptual translation

SIYENETSAVTFILVGFSEYPHLQVPLFLLFLTIYTVTVLGNLGMIALIRISHKLHTPMY
FFLSHLSFVDFCYSTVVTPKLLENLIVEDRRISFTGCVMQFFFACIFVVTETFMLAVMAY
DRFVAVCNPLLYTVAMSQKPCWSLVATSCSWSIICSFIFIHFMLTLVFCGTKFINNFVCE
HDAIVAVSCSDPYISQKVI\SLLSSLLIILTSYVFIVITVMKMPTTGGRYKVFSTCVSH
LTTITIFHSIIICLYCVPTTKSSWLLVKVASVFYTVIIPMLNPLIYSLRNKDVKDAVKKL
MCSTLSS