Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5d46 Olfactory Receptor

Gene Symbol Or5d46
Organism Mouse
Family 5
Subfamily d
Pseudo No
Location chr2:88339567-88340511 (+)
Aliases Olfr1176, RP23-390B17.8, MGC157563, MOR174-5, RP23-390B17.8, MGC157563, MOR174-5

Sequence information


Nucleotide sequence

ATGCAGCATCAAGTGAATCAGAGTACTGGAGTCGTATTTGTCTTCGTGGGATTCTCAGAG
TATCCGAACTTACAGGTGCCTTTATTCCTGATCTTTTTGATCATATACACCATCACTGTT
TTGGAAAATCTAGGAATGATTTTGGTCATCAGGATCAATGCTAAGCTCCATACTCCTATG
TACTTTTTCCTCAGCCATTTATCCATTGTTGATCTTTGTTACACCACTGTGATTGCCCCA
AAACTGTTAGACCTTCTGATAACAGAGGACAGATCCATGTCCCTCAAAGGATGCATAATT
CAGTTTTACTTTGGCTGTGCTTGTGTGGTTACCCAAAACTTCATGTTAGCAGTAATGGCC
TATGATCGCTTTGTGGCCATTTGTAACCCTCTGCTCTACACAGTGGCTATGTCTCAGAAG
CTCTGTGCTCTCCTAGTAACTGGAACTTACCTATGGGGTGGGCTCTGTGCCACCACACTA
ACATATTTTCTATTGGCATTATCTTACTGTAGATCTTCCATCATTAACCACTTTTGCTGT
GAGTACTCTGCCATAATTTCTGCAGCCTGTTCTGATTCTTCTATCAGCCAGATAGCGTGC
TTGTTAATTTGCATGTTCAATGAGATTTGTAGCCTCCTTATCATCATTGTCTCATATGTT
GTCATATTCACCACTGTTATCAAGATCCCCACTAAAGGAGCACTACAAAAAGCCTTGTCC
ACCTGTGCTCCACACCTGACTGCCATCTCTTTCTGCCATGGGATTATTCTCCTTCTATAC
TGCGTGCTCAAGTCAAAGAGCTCACTGCTTCTTGTTAAGATAGTCACTGTGTTTTACAGT
ATGGTTATCCCTATGCTTAATCCTCTTATTTACAGCCTAAGAAATAAGGATGTAAAAGAG
ACTGTGAGGAAATTAATCCATATGAAAATCCTTTCTCAGTCATTA


Conceptual translation

MQHQVNQSTGVVFVFVGFSEYPNLQVPLFLIFLIIYTITVLENLGMILVIRINAKLHTPM
YFFLSHLSIVDLCYTTVIAPKLLDLLITEDRSMSLKGCIIQFYFGCACVVTQNFMLAVMA
YDRFVAICNPLLYTVAMSQKLCALLVTGTYLWGGLCATTLTYFLLALSYCRSSIINHFCC
EYSAIISAACSDSSISQIACLLICMFNEICSLLIIIVSYVVIFTTVIKIPTKGALQKALS
TCAPHLTAISFCHGIILLLYCVLKSKSSLLLVKIVTVFYSMVIPMLNPLIYSLRNKDVKE
TVRKLIHMKILSQSL