Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5d47 Olfactory Receptor

Gene Symbol Or5d47
Organism Mouse
Family 5
Subfamily d
Pseudo No
Location chr2:87973710-87974663 (-)
Aliases Olfr74, RP23-24C12.1, MOR174-4, mOR-EV, RP23-24C12.1, MOR174-4, mOR-EV

Sequence information


Nucleotide sequence

ATGATACTGTCTGAAAAAAACAATAGTGGGATTATTTTCACCCTCTTGGTCTTCTCAGAT
TATCCTGACCTTAAAGTCCCTCTCTTCTTGGTGTTTCTCGTCATTTACAGCATCACTGTG
GTAGGAAATATTGGTATGATCCTCGTGATCAGAATTAATCCCCAACTGCATTCCCCTATG
TACTTCTTCCTCAGCCACCTCTCCTTTGTGGATTTCTGCTATTCTTCCATCATTGCTCCC
AAGATGCTGGTGAACCTTGTTGCAAAAGACATAACCATTTCATTTGTAGAATGCATAGTA
CAATATTTTTTATTTTGTGTCTTTGTAGTAACTGAAGCCTTTTTATTAGTGGTTATGGCA
TATGACCGATTTGTGGCTATCTGTAACCCTCTGCTCTACACAGTAGCCATGTCCCAGAAA
CTCTGTATCACACTGGTGGTGGGATCCTACGCATGGGGGTTCACATGTTCCTTGACACTG
ACGTGTTCTACTGTGCAATTATCTTTTCATGGTGTCAATAGGATCGATCACTTCTTCTGT
GAACTCTCTTCACTGCTAGCCCTTTCTTCCTCTGATACTCTCATCAGTCAATTACTGCTG
TTTGTCTTTGCCACATTTAATGCTGTCAGCACATTACTCCTTATTCTGCTGTCTTACCTG
TTCATTGTTGTCACTGTCCTTAAGATGCGTTCAGCCAGTGGGCGTCGTAAGGCTTTCTCC
ACCTGTGCATCCCACCTGGCAGCCATCACTATCTTCCATGGTACCATTTTATTCCTTTTT
TGTGTGCCCAACTCTAAGAATTCCAGGCTCACAGTCAAAGTGGGCTCTGTGTTTTACACA
GTGGTGATCCCCATGCTTAACCCCATAATCTATAGTCTGAGAAATAAGGATGTCCAAGAT
ACAATTAGAAAAATAATGACCCTTATCTCATGTGTTAAGAATGATAGACACAAT


Conceptual translation

MILSEKNNSGIIFTLLVFSDYPDLKVPLFLVFLVIYSITVVGNIGMILVIRINPQLHSPM
YFFLSHLSFVDFCYSSIIAPKMLVNLVAKDITISFVECIVQYFLFCVFVVTEAFLLVVMA
YDRFVAICNPLLYTVAMSQKLCITLVVGSYAWGFTCSLTLTCSTVQLSFHGVNRIDHFFC
ELSSLLALSSSDTLISQLLLFVFATFNAVSTLLLILLSYLFIVVTVLKMRSASGRRKAFS
TCASHLAAITIFHGTILFLFCVPNSKNSRLTVKVGSVFYTVVIPMLNPIIYSLRNKDVQD
TIRKIMTLISCVKNDRHN