Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5g23 Olfactory Receptor

Gene Symbol Or5g23
Organism Mouse
Family 5
Subfamily g
Pseudo No
Location chr2:85607967-85608908 (-)
Aliases Olfr1000, RP23-16D18.5, MOR175-9, RP23-16D18.5, MOR175-9

Sequence information


Nucleotide sequence

ATGGAAGAAAAGAATCAGACTGTCATGCCTGAGTTTCTCTTCCGTGGCATTACAGATAAC
CTCCATCAGAAGATTGTCATCTTCATCATTTTTTTCTTTGTTTATCTTGTTACTCTTGGG
GGTAATGTGGGGATGATCACTCTCATATGGTTGGACCCCAGGCTGCACACACCTATGTAC
TTTTTTCTCAGCCAACTGTCCTTTGTAGATGTGTCTTCCTCTTCTTCCATAGCTCCCAAG
ATGCTGTGTGACATTTTTGCAAGGAACAAAGCCATCTCTTTTGTGGGCTGTGCAACACAG
ATGTGGTTCTTTGGTCTCTTTGTGGCAACTGAATGCTTTCTCCTGGCTGCCATGGCATAT
GATCGGTATGCAGCCATATGTAAGCCCTTGCTGTACACACTTATTATGTCTCCACATCTC
TGTATGTTGTTGGTTGTTGGGATTTATTTCATTGCTCTTATAAGTACAATGATACACACA
ACTTTGACCTTTTGCTTACCATTCTGTGGTCCATATATTATCAACCACTTTTTCTGTGAT
GTTTCTCCATTGCTGTCTCTAGCATGTACTGACACGCAGATGATTAAGTTGGTGTTTTTT
GTCTTGGCTGGCACAGTAGGTATGTTCACTGGTCTGATAATTCTGGGGTCCTATGTATGC
ATCTTGAAGGCAATTTTGAAGATTCAGACAGCCAATGGGAGACAAAAAGCCTTCTCAACT
TGTTCCTCTCACTTGGTGACTGTCGCTATCCTGTATGGGACTCTTTTCTTCATCTATGTT
CGACCCAATGCCAGTTCCTCCTTGAATATTAATAAAGTGATCTCTTTATTTTACACTGTG
GTGATCCCCATGTTGAATCCCCTCATCTACAGCTTGAGGAACCAAGAGGTAAAAAATGCA
TTCAGGAGAACTTTGAAGAAGAAGCACTTCCTAATAGGTGTT


Conceptual translation

MEEKNQTVMPEFLFRGITDNLHQKIVIFIIFFFVYLVTLGGNVGMITLIWLDPRLHTPMY
FFLSQLSFVDVSSSSSIAPKMLCDIFARNKAISFVGCATQMWFFGLFVATECFLLAAMAY
DRYAAICKPLLYTLIMSPHLCMLLVVGIYFIALISTMIHTTLTFCLPFCGPYIINHFFCD
VSPLLSLACTDTQMIKLVFFVLAGTVGMFTGLIILGSYVCILKAILKIQTANGRQKAFST
CSSHLVTVAILYGTLFFIYVRPNASSSLNINKVISLFYTVVIPMLNPLIYSLRNQEVKNA
FRRTLKKKHFLIGV