Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5g24-ps Olfactory Receptor

Gene Symbol Or5g24-ps
Organism Mouse
Family 5
Subfamily g
Pseudo Yes
Location chr2:85633431-85634369 (+)
Aliases Olfr1001-ps1, MOR175-6, MOR175-6

Sequence information


Nucleotide sequence

ATGGAAAGAAAGAATCAGACCACAGTGCTTGAGTTTCTTTTCCTGGGCCTTACAGATTAT
CTCCATCAGAAGGTTGTTCTCTTCATCATATTTTTCCTTGTGTATCTTGTCACCCTGGCA
GGTAATGTGGGTATGATCAATCTCATATGGGTAGACCCCAGGCTGCACACGCCAATGTAC
TTTTTCCTCAGCCAGCTGGCCTTTGTAGATGTGTGCTCCTCTTCCTGTGTAGCTCCCAAG
ATGCTGAGTGACATTTTTGCAGAGAAGAAAGCCATTTCTTTTATGGGCTGTGCAGCACAG
ATGTGGTTCTTTGGTCTTTTTGTGACAACTGATTGTTTCCTCCTAGCTGCCATGGCTTAT
GATTGATATACGGCTGTCTGCAAACCCTTACTGTACAGTGTCATTATGTCCAAGAGGGTC
TGTGTTCAGTTTGTCATAGGACCTTATCTTTTAGCTGCTATAAACATCACAACTCATACA
ACATTGACCTTTTGCTTACCGTTCTGTGGTTCAAATACCATCAACCATTTCTTCTGTGAT
GTTTCCCCACTGCTTTCATTAGCATGTGCTGACACATGGATTAACAAGGTAGTACTTTTT
GTCCTGGCTGGAGTGATAGGTGTTCCCAGTGGCTTGATAATCATAGTTTCCTATGTGTGC
ATCCTGGTGGCTATCTTGAAGATCAAGACTGCTGATGGGAGACAGAAAGCCTTCTCCACG
TGTTCTTCTCACCTGGCAGCTGTCTCAATTCTTTATGGCACTCTTTTCTTCATATATGTT
CGGCCTAATGCAAGTTCTTCCCTAGATATTAATAAAGTGATCTCTTTATTTTATACGGTG
GTGATCCCCATGTTGAATCCCCTCATTTATAGCTCGAGGAACAAAGAGGTGAAAGATGCA
GTTAAGAGAATATTGAGAAGTAATCACTTCTTAACAGGT


Conceptual translation

MERKNQTTVLEFLFLGLTDYLHQKVVLFIIFFLVYLVTLAGNVGMINLIWVDPRLHTPMY
FFLSQLAFVDVCSSSCVAPKMLSDIFAEKKAISFMGCAAQMWFFGLFVTTDCFLLAAMAY
D*YTAVCKPLLYSVIMSKRVCVQFVIGPYLLAAINITTHTTLTFCLPFCGSNTINHFFCD
VSPLLSLACADTWINKVVLFVLAGVIGVPSGLIIIVSYVCILVAILKIKTADGRQKAFST
CSSHLAAVSILYGTLFFIYVRPNASSSLDINKVISLFYTVVIPMLNPLIYSSRNKEVKDA
VKRILRSNHFLTG