Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5g25 Olfactory Receptor

Gene Symbol Or5g25
Organism Mouse
Family 5
Subfamily g
Pseudo No
Location chr2:85647366-85648319 (-)
Aliases Olfr1002, RP23-16D18.7, MOR175-2, RP23-16D18.7, MOR175-2

Sequence information


Nucleotide sequence

ATGATGCACAGAAATCAAACTGTTGTGACTGAGTTCTTCTTCACTGGATTAACCTCCTCC
TTCCATCTCCAAATTGTCCTCTTCCTGACATTTCTCTGTGTTTATCTCGCAACTCTTCTG
GGGAACCTGGGAATGATCATTCTTATTCACCAGGACACTCGACTCCACATCCCCATGTAC
TTTTTTCTAAGCCACTTGTCCTTTGTGGATGCCTGCTCCTCTTCTGTCATAAGTCCTAAG
ATGTTGTCTGACATCTTTGTGGATAAAAAGGTGATCTCCTTCTTAGGTTGTGCTATCCAG
TTTTGTTTATTCAGCCAGTTTGTAGTGACAGAATGTTTCCTCCTGGCCTCCATGGCTTAT
GATAGATATGTTGCCATCTGTAAGCCTTTGCTGTATACTCTCATCATGTCCCAGCGAGTC
TGTGTACAGTTAGTGATTGGCCCTTACAGCATAGGCCTTATAAGCACTGTGGTCCATACT
ACTTCTGCATTTATTCTTCCATACTGTGGTCCAAATCTCATCAATCACTTTTTCTGTGAC
CTTCTTCCTGTCCTCTCACTGGCATGTGCAGATACTCAGATGAATAAACATTTGCTTTTC
ATCATGGCTGGGATCCTAGGTGTATTCAGTGGTATAATCATATTGGTGTCCTATGTTTAC
ATTGCCATCACCATCCTAAAGATCAATTCTGCTGATGGGAGGCGCAAAGCCTTCTCCACC
TGCTCTTCACACCTGACAGCAGTCTCTATTCTTTACGGGACTCTCTTCTTTATCTATGTA
CGTCCAAGCTCCAGCTTCTCTCTGGATATCAATAAAGTTGTGTCACTATTTTACACTGCT
GTAATCCCTATGTTGAACCCATTCATTTATAGCTTGAGAAATAAGGAAGTCAAAGATGCA
TTAATCAGGACATTTGAAAAGAAGTTTTGCTACAGCTTGCAAGATAAAATATTA


Conceptual translation

MMHRNQTVVTEFFFTGLTSSFHLQIVLFLTFLCVYLATLLGNLGMIILIHQDTRLHIPMY
FFLSHLSFVDACSSSVISPKMLSDIFVDKKVISFLGCAIQFCLFSQFVVTECFLLASMAY
DRYVAICKPLLYTLIMSQRVCVQLVIGPYSIGLISTVVHTTSAFILPYCGPNLINHFFCD
LLPVLSLACADTQMNKHLLFIMAGILGVFSGIIILVSYVYIAITILKINSADGRRKAFST
CSSHLTAVSILYGTLFFIYVRPSSSFSLDINKVVSLFYTAVIPMLNPFIYSLRNKEVKDA
LIRTFEKKFCYSLQDKIL