Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5g26 Olfactory Receptor

Gene Symbol Or5g26
Organism Mouse
Family 5
Subfamily g
Pseudo No
Location chr2:85663479-85664432 (-)
Aliases Olfr154, RP23-16D18.10, 912-93, MOR175-1, OR93, Olfr4-, RP23-16D18.10, 912-93, MOR175-1, OR93, Olfr4-

Sequence information


Nucleotide sequence

ATGATGCACAGAAATCAAACTGTTGTGACTGAGTTCTTCTTCACTGGATTAACCTCCTCC
TTCCATCTCCAAATTGTCCTCTTCCTGACATTTCTCTGTGTTTATCTCGCAACTCTTCTG
GGGAACCTGGGAATGATCATTCTTATTCACCTGGACACTCGACTCCACATCCCCATGTAC
TTTTTTCTCAGCCACTTGTCCTTTGTGGATGCCTGCTCCTCTTCTGTCATAAGTCCTAAG
ATGTTGTCTGACATGTTTGTGGATAAAAAGGTGATCTCCTTCTTAGGTTGTGCTATCCAG
CTTTGTTTATTTAGCCAGTTTGTAGTGACAGAATGTTTCCTCCTGGCCTCCATGGCTTAT
GATCGGTATGTTGCCATCTGTAAGCCTTTGCTGTATACTCTCATCATGTCCCAGCGAGTC
TGTGTACAGTTAGTGATTGGCCCTTACAGCATAGGCTTTGTAAGCACTATGGTCCATATT
ATTTCTGCATTTGTCCTTCCATACTGTGGTCCAAATCTCATCAATCACTTTTTCTGTGAC
CTTCTTCCTGTCCTCTCACTGGCATGTGCAAATACTCAGATGAAAAAACGTTTGCTTTTC
ATCGTGGCTGGGATCCTAGGTGTATTCAGTGGTATAATCATATTGGTGTCCTATGTTTAC
ATTGCCATCACCATCCTAAAGATCAGTTCTGCTGATGGGAGGCGCAAAGCCTTCTCCACC
TGCTCTTCACACCTGACAGCAGTCTCTATTCTTTACGGGACTCTCTTCTTTATCTATGTA
CGTCCAAGCTCCAGCTTCTCTCTGGATATCAATAAGGTTGTGTCACTATTTTATACCACT
GTTATCCCTATGTTGAACCCATTCATTTATAGCCTGAGAAATAAGGAAGTCAAAGATGCA
TTAATCAGGACATTTGAAAAGCAGTTTTGCTACAGCTTTCAAGATAAAATACTA


Conceptual translation

MMHRNQTVVTEFFFTGLTSSFHLQIVLFLTFLCVYLATLLGNLGMIILIHLDTRLHIPMY
FFLSHLSFVDACSSSVISPKMLSDMFVDKKVISFLGCAIQLCLFSQFVVTECFLLASMAY
DRYVAICKPLLYTLIMSQRVCVQLVIGPYSIGFVSTMVHIISAFVLPYCGPNLINHFFCD
LLPVLSLACANTQMKKRLLFIVAGILGVFSGIIILVSYVYIAITILKISSADGRRKAFST
CSSHLTAVSILYGTLFFIYVRPSSSFSLDINKVVSLFYTTVIPMLNPFIYSLRNKEVKDA
LIRTFEKQFCYSFQDKIL