Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5g27 Olfactory Receptor

Gene Symbol Or5g27
Organism Mouse
Family 5
Subfamily g
Pseudo No
Location chr2:85,579,200-85,580,200 (+)
Aliases Olfr996

Sequence information


Nucleotide sequence

MEEKNQTVMPEFLFLGITDNFHQKIVIFIIFFFVYLVTLGGNVGMIALIWLDPRLHTPMY
FFLSQLSFVDVSSSSSIAPKMLCDIFARNKAISFVGCAAQMWFFGLFVATECFLLAAMAY
DRYAAICKPLLYTLIMSPHLSVLLVIGPYAIALISTTTHTTLTFCLPFCGPYIINHFFCD
ISPLLSLACSDTHINKLVLFVLAGTVGVLSGLIILVSYVCILKAILKIQTANGRRKAFST
CSSHLATVSILYGTLFFIYVRPNVSSSLNINKVISLFYTMVIPMLNPLIYSLRNQEVKNA
FRRTLEKKHFLTGA


Conceptual translation

MEEKNQTVMPEFLFLGITDNFHQKIVIFIIFFFVYLVTLGGNVGMIALIWLDPRLHTPMY
FFLSQLSFVDVSSSSSIAPKMLCDIFARNKAISFVGCAAQMWFFGLFVATECFLLAAMAY
DRYAAICKPLLYTLIMSPHLSVLLVIGPYAIALISTTTHTTLTFCLPFCGPYIINHFFCD
ISPLLSLACSDTHINKLVLFVLAGTVGVLSGLIILVSYVCILKAILKIQTANGRRKAFST
CSSHLATVSILYGTLFFIYVRPNVSSSLNINKVISLFYTMVIPMLNPLIYSLRNQEVKNA
FRRTLEKKHFLTGA