Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5g27b Olfactory Receptor

Gene Symbol Or5g27b
Organism Rat
Family 5
Subfamily g
Pseudo No
Location chr3:72990358-72991299 (+)
Aliases Olr444, Olr444

Sequence information


Nucleotide sequence

ATGGAAGAAAAGAATCAGACTGTCATGCCGGCGTTTCTCTTCCTTGGCATTACAGATAAC
CTCCATCAGAAGATTGTCATCTTCATCATCTTTTCCTTTGTTTATCTTGTCACTCTTGGA
GGCAATGTGGGGATGATAACTCTCATATGGTTGGACCCCCGGCTGCACTCGCCTATGTAT
TTTTTTCTCAGCCACCTGTCCTTTGTAGATGTGTGCTCCTCTTCTTCTATAGCTCCCAAG
ATGCTGTGCGACATTTTTGCAGAGAACAAAACCATCTCTTTTGTGGGCTGTGCAGCACAG
ATGTGGTTCTTTGGTCTCTTTGTGGCAACTGAATGCTTTCTCCTGGCTGCCATGGCATAT
GACCGGTATGCAGCCATCTGTAAGCCCTTGCTGTATACACTTATTATGTCTCCACATCTC
TGTGTGTTGTTGGTTATTGGGCCTTATGCCATTGCTCTTATAAGTACAATGACACATACA
ACTTTGACCTTTTGCTTACCATTCTGTGGTCCATATATTATCAACCACTTTTTCTGTGAC
ATTTCACCATTGCTGTCTCTAGCATGTACTGACACTAAGTTCAATAAGGTAGTGCTTTTT
GTCTTGGCTGGAGCAGTTGGTGTGTTCAGTGGTCTGATCATCCTGATGTCCTATGTCTGC
ATTTTGATGGCAATTTTGAAGATTCAGACAGCTAATGGGAGATGCAAAGCCTTCTCAACT
TGTTCCTCTCACTTGGCAGCTGTCTCTATCCTGTATGGGACTCTTTTCTTTATCTATGTT
CGACCCAATGCCAGCTCCTCCTTGAATATTAATAAAGTGATCTCCTTATTTTACACTCAG
GTGATCCCCATGTTAAATCCTGTCATCTACAGCTTTAGGAACAAAGAGGTAAAAGATGCA
TTTAGGAGAAATTTGCAGAAGAAGCACTTCCTAGTAGGTGCT


Conceptual translation

MEEKNQTVMPAFLFLGITDNLHQKIVIFIIFSFVYLVTLGGNVGMITLIWLDPRLHSPMY
FFLSHLSFVDVCSSSSIAPKMLCDIFAENKTISFVGCAAQMWFFGLFVATECFLLAAMAY
DRYAAICKPLLYTLIMSPHLCVLLVIGPYAIALISTMTHTTLTFCLPFCGPYIINHFFCD
ISPLLSLACTDTKFNKVVLFVLAGAVGVFSGLIILMSYVCILMAILKIQTANGRCKAFST
CSSHLAAVSILYGTLFFIYVRPNASSSLNINKVISLFYTQVIPMLNPVIYSFRNKEVKDA
FRRNLQKKHFLVGA