Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5g29 Olfactory Receptor

Gene Symbol Or5g29
Organism Mouse
Family 5
Subfamily g
Pseudo No
Location chr2:85590542-85591483 (+)
Aliases Olfr998, RP23-16D18.2, MOR175-5, RP23-16D18.2, MOR175-5

Sequence information


Nucleotide sequence

ATGGAAGAAAAGAATCAGACTATTGTAATGGAGTTTTTCTTCCTGGGCCTAACAGATCAT
CTCTATCAGAAGATTGCACTTTTCATCACGATCCTCTTTGTTTATCTTGTCACACTGGGA
GGCAACTTGGGCATGATCACTCTCATATGGGCAGACCCCAGGCTGCATACACCTATGTAC
TTTTTTCTCAGCCACTTGTCATTTGTTGATATGTGCTCCTCTTCTTCCATAGCTCCTAAG
ATGCTCTGTGATATCTTTGCAGAGGAGAAAAGGATCTCTTTCATGGGCTGTGCAGCACAG
ATGTGGTTCTTTGGTTTCTTTGTGGGAACTGAGTGTTTCCTGCTTGCTTCCATGGCATAT
GATCGGTACACAGCCATTTGCAAGCCCTTACTGTATACTCTCCTTATGTCTCAGAGGGTA
TGTGTGCATCTGGTTGTAGGGCCATATGTCTTTGCTATTATAAACATCACAACTCATACA
ACCTTGGCTTTTTGCTTACCGTTCTGTGGTTCAAATACCATCAACCATTTCTTCTGTGAT
GTCTCTCCACTTTTATCATTGGCGTGTGCTGACTCTTGGGTTAATAAGGTTGTGCTTTTT
GTTCTTTCTGGAGCCATAGGAGTGTTCAGTGGTCTGATCATCATAGTCTCCTATGTCAGC
ATCTTGATGACAATTTTCAAGATTCAAACTGCTGATGGGAAACAAAAAGCCTTCTCTACT
TGTTCCTCTCACTTGTCAGCTGTCTCCATTCTGTATGGGACACTTTTCTTTATTTATGTT
CGACCCAGTGCAAGTTTTTCCTTAAACATCAACAAAATGATTTCTCTGTTTTATACTGTG
GTGATCCCTATGCTGAATCCCCTCATCTATAGCCTGAGGAACAAAGAAGTGAAAGGTGCA
TTCAGGAGAAAGGTGCAAAAGAAACATTTTCCAGCAGGCAGG


Conceptual translation

MEEKNQTIVMEFFFLGLTDHLYQKIALFITILFVYLVTLGGNLGMITLIWADPRLHTPMY
FFLSHLSFVDMCSSSSIAPKMLCDIFAEEKRISFMGCAAQMWFFGFFVGTECFLLASMAY
DRYTAICKPLLYTLLMSQRVCVHLVVGPYVFAIINITTHTTLAFCLPFCGSNTINHFFCD
VSPLLSLACADSWVNKVVLFVLSGAIGVFSGLIIIVSYVSILMTIFKIQTADGKQKAFST
CSSHLSAVSILYGTLFFIYVRPSASFSLNINKMISLFYTVVIPMLNPLIYSLRNKEVKGA
FRRKVQKKHFPAGR