Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5g29 Olfactory Receptor

Gene Symbol Or5g29
Organism Rat
Family 5
Subfamily g
Pseudo No
Location chr3:73,003,100-73,004,000 (+)
Aliases Olr446

Sequence information


Nucleotide sequence

ATGGAAGAAAAGAATCAGACTATTATAACAGAGTTTCTCTTCCTGGGTCTAACAGATCAT
CTCCATCAGAAGATTGCACTTTTCATCACACTCCTCTTTGTTTATCTTGTCACACTGGGG
GGCAACTTGGGCATGATCACTCTCATATGGGTGGACCCCAGACTGCACACACCTATGTAC
TTCTTTCTCAGTCACCTGTCATTTGTTGATTTGTGTTCCTCTTCTTCCATAGCTCCTAAG
ATGCTCTGTGATATCTTTGCAAAGAAAAAAAAGATCTCTTTTATGGGCTGTGCAGCACAG
ATGTGGTTCTTTGGTTTCTTTGTGGGAACTGAGTGTTTCCTGCTTGCTTCCATGGCATAT
GATCGGTATACAGCCATTTGCAAGCCCTTGTTGTATACTCTCCTCATGTCTCAGAGGGTA
TGTGTGCATCTGGTTGTAGGGCCATATGCCTTTGCTATTATAAACATTACAACTCATACA
ACCTTGACTTTTTGTTTACCATTCTGTGGTTCAAATACTATCAACCATTTCTTCTGTGAT
GTTTCTCCACTTTTTTCATTGGCATGTGCCGACTCCTGGATTAATAAGGTTGTGCTTTTT
GTCTTTTCTGGAGCTATAGGAGTGTTCAGTGGTCTGATAATCATAGTCTCCTATGTTAGC
ATCTTGATGACAATTTTGAAGATTCAAACTGCTGATGGAAAACGGAAAGCCTTCTCTACA
TGTTCCTCTCACTTGGCAGCTGTTTCCATCCTATATGGGACTCTTTTCTTTATTTATGTT
CGACCCAGTGCTAGTTTTTCCTTGAATATCAACAAAATGATTTCTCTGTTTTATACTGTG
GTGATCCCTATGCTGAACCCTCTCATTTATAGCTTGAGGAACAAGGAAGTGAAAGGTGCA
TTCAGGAGAAAGGTACAAAGGAAGCATTTTCCAGCAGGTATG


Conceptual translation

MEEKNQTIITEFLFLGLTDHLHQKIALFITLLFVYLVTLGGNLGMITLIWVDPRLHTPMY
FFLSHLSFVDLCSSSSIAPKMLCDIFAKKKKISFMGCAAQMWFFGFFVGTECFLLASMAY
DRYTAICKPLLYTLLMSQRVCVHLVVGPYAFAIINITTHTTLTFCLPFCGSNTINHFFCD
VSPLFSLACADSWINKVVLFVFSGAIGVFSGLIIIVSYVSILMTILKIQTADGKRKAFST
CSSHLAAVSILYGTLFFIYVRPSASFSLNINKMISLFYTVVIPMLNPLIYSLRNKEVKGA
FRRKVQRKHFPAGM