Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5g9 Olfactory Receptor

Gene Symbol Or5g9
Organism Mouse
Family 5
Subfamily g
Pseudo No
Location chr2:85721407-85722348 (+)
Aliases Olfr1009, RP23-16D18.13, MOR175-3, RP23-16D18.13, MOR175-3

Sequence information


Nucleotide sequence

ATGGCGGATGAGAACTATACAAGGATCACAGAATTCATTTTCATTGGCTTGAGATACCAC
CCTAATCTGCAGGTCTTCCTGTTCTTGCTCTTTCTGCTTTTTTACCTGGTTACCATGACG
GGAAACTTAGGTATGATCATTCTCATTCGGGTAGATTCTCGCCTTCACACTCCAATGTAC
TTTTTCCTCAGCCACCTGTCATTTGTGGACATTTGCTTCTCGTCAGTCGTGGCCCCCAAG
ATGCTCACAGACTTCTTTGCAGATAAAAAAGCTATCTCTTTTCTGGGCTGTGTATTACAG
CAATGGTTCTTTGGGTTCTTTGTGGCCATTGAGTGTCTTCTCTTGGCATCCATGGCCTAT
GACAGATATGTAGCCATCTGTAACCCCCTGTTGTATTCAGTAGCCATGTCCCAGAGACTC
TGCATACAGCTGGTGATCGGACCCTATGCTGTTGGCTTTTTTAATACCATGACTCACACG
ACAGCTGCTTTCCGACTTCCCTTTTGTGGCTCCAATATTATCAATCATTTCTTCTGTGAC
ATGTCTCCTATCCTTTCCCTCATATGTGCTGACATACGGATCAACAAACTGTTGGTTTTC
ATCGTGGCAGGCGCTGTATTGATTGTCAGTAGTACCACCATCATAGTCTCCTACTTTCAC
ATCCTCATTGCCATCCTGAGAATCCGCTCAGCTGAAGGTAGGAGGAAAGCCTTCTCTACC
TGCTCTTCCCATGTTACAGCAGTTTCTATTTTGTACGGGACTCTCTTCTTTATCTATGTG
AGGCCAAGCGCCATTTCTTCTCTGGACCTCAATAAGGTGGTGTCTGTTTTCTACACAGCA
GTGATTCCCATGCTTAACCCGCTCATCTACAGCCTGAGGAATAAAGAAGTGAAATCGGCC
ATGGGCAGGACAGTTGCTAAAGCCAAAGTTTTCCTCAAAAAT


Conceptual translation

MADENYTRITEFIFIGLRYHPNLQVFLFLLFLLFYLVTMTGNLGMIILIRVDSRLHTPMY
FFLSHLSFVDICFSSVVAPKMLTDFFADKKAISFLGCVLQQWFFGFFVAIECLLLASMAY
DRYVAICNPLLYSVAMSQRLCIQLVIGPYAVGFFNTMTHTTAAFRLPFCGSNIINHFFCD
MSPILSLICADIRINKLLVFIVAGAVLIVSSTTIIVSYFHILIAILRIRSAEGRRKAFST
CSSHVTAVSILYGTLFFIYVRPSAISSLDLNKVVSVFYTAVIPMLNPLIYSLRNKEVKSA
MGRTVAKAKVFLKN