Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5g9 Olfactory Receptor

Gene Symbol Or5g9
Organism Rat
Family 5
Subfamily g
Pseudo No
Location chr3:73089269-73090210 (+)
Aliases Olr453, Olr453

Sequence information


Nucleotide sequence

ATGGCGGATGAGAACTATACAAGGATCACAGAATTCATTTTCATTGGCTTGAGATACCAC
GCTAAGCTTCAGGTCTTCCTGTTCCTGCTCTTTCTTCTTTTTTACCTGGTTACTATGACT
GGAAACTTGGGTATGATCATTCTCATCCGAGTAGACTCTCGTCTTCACACTCCTATGTAC
TTTTTCCTCAGCCACCTGTCCTTTGTGGACATCTGCTTCTCATCAGTCGTGGGCCCCAAG
ATGCTCATGGACTTCTTCGCAGATAGAAAAGTTATCTCTTTTCTGGGCTGTGTCTTACAG
CAATGGTTCTTTGGGTTCTTTGTGGCCATCGAGTGCCTTCTCTTGGCATCCATGGCCTAT
GACCGCTATGTCGCCATCTGTAATCCCCTGTTGTATTCAGTAGCCATGTCCCAGAGACTC
TGCATACAGCTGGTGGTCGGACCGTATGCTGTTGGCTTTTTCAACACCATGACTCACACA
ACAGCTGCTTTCCGACTTCCCTTTTGCGGCTCTAACATTATCAATCACTTCTTCTGTGAC
ATGTCTCCTATCCTTTCCCTCATCTGTGCTGACATACGGATCAACAAACTGTTGGTTTTC
GTTGTGGCAGGAGCTGTATTAGTTGTCAGTAGCACCACCATCATAATTTCCTACTTTCAC
ATCCTCATCGCTATCCTGAGGATCCGCTCGGCTGAAGGGAGGAGGAAAGCCTTCTCTACC
TGCTCCTCCCATGTTACAGCAGTTTCCATTTTGTACGGGACTCTCTTCTTCATCTACGTG
CGTCCAAGTGCCATTTCTTCTCTGGACCTCAATAAGGTGGTGTCTGTGTTCTACACAGCT
GTGATTCCCATGCTTAACCCGCTCATCTACAGTCTGAGGAATAAAGAGGTGAAAGCGGCC
ATGGGCAGGACAGTAGCCAAGGCCAAAGTTTTCCTCAAAAAT


Conceptual translation

MADENYTRITEFIFIGLRYHAKLQVFLFLLFLLFYLVTMTGNLGMIILIRVDSRLHTPMY
FFLSHLSFVDICFSSVVGPKMLMDFFADRKVISFLGCVLQQWFFGFFVAIECLLLASMAY
DRYVAICNPLLYSVAMSQRLCIQLVVGPYAVGFFNTMTHTTAAFRLPFCGSNIINHFFCD
MSPILSLICADIRINKLLVFVVAGAVLVVSSTTIIISYFHILIAILRIRSAEGRRKAFST
CSSHVTAVSILYGTLFFIYVRPSAISSLDLNKVVSVFYTAVIPMLNPLIYSLRNKEVKAA
MGRTVAKAKVFLKN