Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5i1 Olfactory Receptor

Gene Symbol Or5i1
Organism Rat
Family 5
Subfamily i
Pseudo No
Location chr3:75936795-75937736 (+)
Aliases Olr588, Olr588

Sequence information


Nucleotide sequence

ATGGAATTTACAAATGGAAACTACACATTGGTCACTGAATTTATCCTCTTAGGATTTCCA
ACACGACCTGAACTCCAAATCATCTTATTCCTTCTGTTTCTGATGTTATATGGTATGATA
TTGATAGGGAATATTGGCTTGATGTTGTTAATTAGGACGGACTCACATCTTCAAACTCCT
ATGTACTTTTTCCTCAGCAACCTCTCCTTTGTAGACCTTTGTTATTCCTCAGTCATTGTT
CCCAACATGCTTGTTAATTTCCTCTCATCAAAGAAATCTATCTCTTACCTTGGCTGTGCG
TTGCAATTTTATTTCTTCTGCACATTTGCAGATACTGAATCCTTTATCTTGGCTGCCATG
GCTTATGATCGCTACGTTGCCATTTGCAATCCTTTGTTATACACAGTTGCAATGTCCAAG
AGTCTCTGCACATGGTTAATCGTGCTGTCATATGTTGGTGGCAACATGAGTTCCCTTGTT
CACACATCTTTCGCCTTTATTCTGAAATATTGTGACAAAAATATCATTAATCATTTCTTC
TGCGACCTCCCTCCTCTCCTGAAGCTTTCCTGTACAGACACGTCCATTAATGAGTGGCTA
CTTTCCACTTATGGGAGTTCCGTGGAGGTCATCTGTTTCTTCATCATCATCATCTCCTAC
TTTTTCATCCTTCTCTCAGTCTTGAAGATCCGGTCTACGAGTGGGAGAAAAAAAACCTTC
TCCACATGTGCCTCTCACCTGACCTCTGTGGCCATCTATCAGGGCACACTTCTATTCATT
TATTCTCGGCCCAGCTCCCTATATTCCCCAAATACAGATAAAATCATCTCAGTGTTCTAC
ACCATTATTATCCCAGTGCTGAATCCACTTATTTATAGTTTGAGAAATAAAGATGTAAAG
GATGCTGCCAAGAAAGCTCTAAGGTCTAAAATACAATCCTCA


Conceptual translation

MEFTNGNYTLVTEFILLGFPTRPELQIILFLLFLMLYGMILIGNIGLMLLIRTDSHLQTP
MYFFLSNLSFVDLCYSSVIVPNMLVNFLSSKKSISYLGCALQFYFFCTFADTESFILAAM
AYDRYVAICNPLLYTVAMSKSLCTWLIVLSYVGGNMSSLVHTSFAFILKYCDKNIINHFF
CDLPPLLKLSCTDTSINEWLLSTYGSSVEVICFFIIIISYFFILLSVLKIRSTSGRKKTF
STCASHLTSVAIYQGTLLFIYSRPSSLYSPNTDKIISVFYTIIIPVLNPLIYSLRNKDVK
DAAKKALRSKIQSS