Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5j1 Olfactory Receptor

Gene Symbol Or5j1
Organism Mouse
Family 5
Subfamily j
Pseudo No
Location chr2:87,048,300-87,049,200 (-)
Aliases Olfr1106

Sequence information


Nucleotide sequence

MADVNFTFVTEFILLGLTDRDELKVFLFILFLLIYVISLVGNLGMFMLIHITPKLHTPMY
HFLRSLSFVDACYSSVFAPTLLLNFFVERETISFSACILQYFLFASLLTTEGFLLAAMAF
DRYVAIVNPLTYTVVMTKLICVLLVLGSCLGGTITSLTHTIGLIKLSFCGPNVISHFFCD
LPPLLKLSCSDTSMNELLLLVFSGVIAITTLLTVVLSYIFIVAAILRIRSAAGRHKAFST
CASHLTAVTLFYGSISFSYIQPSSQYSLEQEKVVSVFYTLVIPMLNPLIYSLRNKEVKDA
VKRVMEIKHSLH


Conceptual translation

MADVNFTFVTEFILLGLTDRDELKVFLFILFLLIYVISLVGNLGMFMLIHITPKLHTPMY
HFLRSLSFVDACYSSVFAPTLLLNFFVERETISFSACILQYFLFASLLTTEGFLLAAMAF
DRYVAIVNPLTYTVVMTKLICVLLVLGSCLGGTITSLTHTIGLIKLSFCGPNVISHFFCD
LPPLLKLSCSDTSMNELLLLVFSGVIAITTLLTVVLSYIFIVAAILRIRSAAGRHKAFST
CASHLTAVTLFYGSISFSYIQPSSQYSLEQEKVVSVFYTLVIPMLNPLIYSLRNKEVKDA
VKRVMEIKHSLH